KEGG   Panthera tigris altaica (Amur tiger): 102951048
Entry
102951048         CDS       T02988                                 

Gene name
CMPK1
Definition
(RefSeq) cytidine/uridine monophosphate kinase 1
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
Module
ptg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102951048 (CMPK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102951048 (CMPK1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     102951048 (CMPK1)
SSDB
Motif
Pfam: ADK AAA_17 Atg14
Other DBs
NCBI-GeneID: 102951048
NCBI-ProteinID: XP_015390891
LinkDB
Position
Un
AA seq 189 aa
MCCSFQKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKDGKIVPVEITISLLKREMDQT
MAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEVMKTFICPHGVXPT
DGQLLKKNKSSGRSDEKRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDE
VVKIFDKEG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtgttgttcctttcagaaatatggctacacacacctttctgcaggagaactccttcgt
gatgaaaggaagaacccagattcacagtatggtgaactcattgaaaagtacattaaagat
ggaaagattgtgccagttgagataaccatcagtttgttaaagagggaaatggatcagaca
atggctgccaatgctcagaagaataaattcttgattgatgggtttccaagaaatcaagac
aaccttcaaggttggaataagaccatggatgggaaggcagatgtgtcttttgttctgttt
tttgactgtaataatgaggtaatgaagaccttcatctgcccacatggggtttaaccaact
gatggtcaactattaaagaaaaacaaaagtagtggtagaagtgatgaaaagagagagagc
ttggaaaagagaattcagacctatcttcagtcaacaaagccaattattgacttatatgaa
gaaatggggaaagtcaagaaaatagatgcctctaagtctgttgatgaagtttttgatgaa
gttgtgaagatttttgacaaagaaggctaa

DBGET integrated database retrieval system