KEGG   Panthera tigris altaica (Amur tiger): 102951132
Entry
102951132         CDS       T02988                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04137  Mitophagy - animal
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04218  Cellular senescence
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04917  Prolactin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04926  Relaxin signaling pathway
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05010  Alzheimer disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05030  Cocaine addiction
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05212  Pancreatic cancer
ptg05215  Prostate cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102951132 (RELA)
   04014 Ras signaling pathway
    102951132 (RELA)
   04064 NF-kappa B signaling pathway
    102951132 (RELA)
   04668 TNF signaling pathway
    102951132 (RELA)
   04066 HIF-1 signaling pathway
    102951132 (RELA)
   04071 Sphingolipid signaling pathway
    102951132 (RELA)
   04024 cAMP signaling pathway
    102951132 (RELA)
   04151 PI3K-Akt signaling pathway
    102951132 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102951132 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102951132 (RELA)
   04218 Cellular senescence
    102951132 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102951132 (RELA)
   04621 NOD-like receptor signaling pathway
    102951132 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102951132 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102951132 (RELA)
   04625 C-type lectin receptor signaling pathway
    102951132 (RELA)
   04660 T cell receptor signaling pathway
    102951132 (RELA)
   04658 Th1 and Th2 cell differentiation
    102951132 (RELA)
   04659 Th17 cell differentiation
    102951132 (RELA)
   04657 IL-17 signaling pathway
    102951132 (RELA)
   04662 B cell receptor signaling pathway
    102951132 (RELA)
   04062 Chemokine signaling pathway
    102951132 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102951132 (RELA)
   04917 Prolactin signaling pathway
    102951132 (RELA)
   04926 Relaxin signaling pathway
    102951132 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102951132 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102951132 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102951132 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102951132 (RELA)
   05202 Transcriptional misregulation in cancer
    102951132 (RELA)
   05203 Viral carcinogenesis
    102951132 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102951132 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102951132 (RELA)
   05221 Acute myeloid leukemia
    102951132 (RELA)
   05220 Chronic myeloid leukemia
    102951132 (RELA)
   05215 Prostate cancer
    102951132 (RELA)
   05222 Small cell lung cancer
    102951132 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102951132 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102951132 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    102951132 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102951132 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102951132 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102951132 (RELA)
   04931 Insulin resistance
    102951132 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102951132 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102951132 (RELA)
   05135 Yersinia infection
    102951132 (RELA)
   05133 Pertussis
    102951132 (RELA)
   05134 Legionellosis
    102951132 (RELA)
   05152 Tuberculosis
    102951132 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102951132 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102951132 (RELA)
   05162 Measles
    102951132 (RELA)
   05164 Influenza A
    102951132 (RELA)
   05161 Hepatitis B
    102951132 (RELA)
   05160 Hepatitis C
    102951132 (RELA)
   05168 Herpes simplex virus 1 infection
    102951132 (RELA)
   05163 Human cytomegalovirus infection
    102951132 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102951132 (RELA)
   05169 Epstein-Barr virus infection
    102951132 (RELA)
   05165 Human papillomavirus infection
    102951132 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102951132 (RELA)
   05145 Toxoplasmosis
    102951132 (RELA)
   05140 Leishmaniasis
    102951132 (RELA)
   05142 Chagas disease
    102951132 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102951132 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102951132 (RELA)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102951132 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102951132
NCBI-ProteinID: XP_015397427
LinkDB
Position
Un
AA seq 577 aa
MSLLRREGAWLHLLSVGKQALPGKDGKWACADPRLPPLSDLFPLIFPTEPAQASGPYVEI
IEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPH
RPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQV
PIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNS
GSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQ
APVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTD
PRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINFEEFSPTVFSSGQIPSQTPALAPA
PAPXXXXXAPAPAPAPILAPGLAQAVVPPAPKTTQAGEGTLTEALLQLQFDADEDLGALL
GSSADPAVFTDLASVDNSEFQQLLSQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPA
PAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgagtctccttcggagggagggagcctggctccatctcctctccgtggggaagcaggcc
ctccctggtaaggatgggaagtgggcttgtgctgaccctcgtctccctcccctttcagac
ctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttatgtggagatc
atcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggtcgctccgcg
ggcagtatccccggcgagaggagcacggataccaccaagacccaccccaccatcaagatc
aatggctacaccgggccagggacagttcgcatctcattggtcaccaaggacccccctcat
cggcctcacccccatgagctggtgggaaaagactgccgggatggcttctatgaggctgag
ctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgtgtaaagaag
cgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatcccttccaagtt
cccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgcttccaggtg
acagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcgcatcccatc
tttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaaccgaaactca
gggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcagaaagaggac
attgaagtgtatttcacgggacccggctgggaggcccgaggctccttttctcaagctgac
gtacaccgacaagtggccattgtgttccggacacctccctatgccgaccccagcctgcag
gcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctcagcgagccc
atggaatttcagtacttgccagacacagatgatcgtcaccggattgaggagaaacgcaaa
aggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatggacccaccgac
ccccggcctccaccccggcgcatcgctgtgccttcccgaagctcagctgccgtccccaag
ccagctccccagccctatccctttacgccatccctcagcaccatcaacttcgaggagttc
tcccccacagtcttctcttccgggcagatcccaagccagacccctgccttggcaccagcc
cctgccccnnnnnnnnnnnnnnncgcccccgccccggcccccgcccccatcttagcccca
ggccttgctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacg
ctgacggaggccctgctgcagctgcagtttgacgctgatgaagacctgggggccctgctt
ggcagcagcgccgacccggcagtgttcacagacctggcatccgtcgacaactctgagttt
cagcagctgctgagccagggtgtatctgtggccccccacccagctgagcccatgctgatg
gaataccctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagct
cccgctcccctgggggcctcggggcttcccaacggcctcctctcgggggatgaagacttc
tcttccattgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system