KEGG   Panthera tigris altaica (Amur tiger): 102951272
Entry
102951272         CDS       T02988                                 

Gene name
IL1B
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04064  NF-kappa B signaling pathway
ptg04217  Necroptosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04657  IL-17 signaling pathway
ptg04659  Th17 cell differentiation
ptg04668  TNF signaling pathway
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04940  Type I diabetes mellitus
ptg05010  Alzheimer disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
ptg05332  Graft-versus-host disease
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102951272 (IL1B)
   04064 NF-kappa B signaling pathway
    102951272 (IL1B)
   04668 TNF signaling pathway
    102951272 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102951272 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102951272 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102951272 (IL1B)
   04620 Toll-like receptor signaling pathway
    102951272 (IL1B)
   04621 NOD-like receptor signaling pathway
    102951272 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    102951272 (IL1B)
   04625 C-type lectin receptor signaling pathway
    102951272 (IL1B)
   04659 Th17 cell differentiation
    102951272 (IL1B)
   04657 IL-17 signaling pathway
    102951272 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102951272 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102951272 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102951272 (IL1B)
   05321 Inflammatory bowel disease
    102951272 (IL1B)
   05332 Graft-versus-host disease
    102951272 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102951272 (IL1B)
   05020 Prion disease
    102951272 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    102951272 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102951272 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102951272 (IL1B)
   04932 Non-alcoholic fatty liver disease
    102951272 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102951272 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102951272 (IL1B)
   05135 Yersinia infection
    102951272 (IL1B)
   05133 Pertussis
    102951272 (IL1B)
   05134 Legionellosis
    102951272 (IL1B)
   05152 Tuberculosis
    102951272 (IL1B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102951272 (IL1B)
   05164 Influenza A
    102951272 (IL1B)
   05162 Measles
    102951272 (IL1B)
   05168 Herpes simplex virus 1 infection
    102951272 (IL1B)
   05163 Human cytomegalovirus infection
    102951272 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102951272 (IL1B)
   05144 Malaria
    102951272 (IL1B)
   05140 Leishmaniasis
    102951272 (IL1B)
   05142 Chagas disease
    102951272 (IL1B)
   05143 African trypanosomiasis
    102951272 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102951272 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102951272 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102951272 (IL1B)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102951272 (IL1B)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102951272 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 102951272
NCBI-ProteinID: XP_007082399
LinkDB
Position
Un
AA seq 269 aa
MAMAAVPELTSEMMAYYSDENDLFFEADGPEKMKGCLQNLSHSFLGDEGIQLQISHQPDD
KSLRHAVSVIVAMEKLKKISFPCSRPLQGEDLKSLFCCIFEEEPIICDTWDDGFVCDAAI
QSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIK
KNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYIS
TSQAEEMPVFLGNTKGGQDITDFTMESAS
NT seq 810 nt   +upstreamnt  +downstreamnt
atggccatggcagcagtacctgaactcaccagtgaaatgatggcttactacagtgatgag
aatgacctgttctttgaggctgatggccccgaaaagatgaagggctgcctccaaaacctg
agccacagttttctgggagatgagggcatccagttgcaaatctcccaccagcccgacgac
aagagtcttaggcatgccgtgtcggtcattgtggctatggagaaactgaagaagatatct
tttccctgctcacggcccctccagggtgaggacctgaagagcctcttttgctgcatcttt
gaagaagaacccatcatctgtgacacgtgggatgacggttttgtgtgtgatgcggccata
cagtcacaggactacacgttccgagacataagccaaaagagcctggtgctgtctggctca
tacgagcttcgggctctccacctcaatggacagaatatgaaccaacaagtggtgttccgc
atgagctttgtgcatggggaggaaaatagtaagaagataccagtagtgttgtgcatcaag
aaaaataatctgtacctgtcctgtgtgatgaaagacgggaaacccaccctacagctggag
atgttagaccccaaagtttacccaaagaagaagatggaaaagcgatttgtcttcaacaag
acagaaatcaagggcaatgtggaatttgagtcttcccagttccccaactggtacatcagc
acctctcaagcagaagaaatgcctgtcttcctaggaaataccaaaggtggtcaggatata
actgacttcacaatggaaagcgcttcctaa

DBGET integrated database retrieval system