KEGG   Panthera tigris altaica (Amur tiger): 102951327
Entry
102951327         CDS       T02988                                 

Gene name
TICAM1
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04064  NF-kappa B signaling pathway
ptg04217  Necroptosis
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102951327 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102951327 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102951327 (TICAM1)
   04621 NOD-like receptor signaling pathway
    102951327 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102951327 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102951327 (TICAM1)
   05133 Pertussis
    102951327 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102951327 (TICAM1)
   05160 Hepatitis C
    102951327 (TICAM1)
   05164 Influenza A
    102951327 (TICAM1)
   05168 Herpes simplex virus 1 infection
    102951327 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102951327 (TICAM1)
   05165 Human papillomavirus infection
    102951327 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102951327 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD TIR_2
Other DBs
NCBI-GeneID: 102951327
NCBI-ProteinID: XP_015399660
LinkDB
Position
Un
AA seq 459 aa
MACTGPSLSGAFDILGAAGQDKLLYLKHKLKTVHQGCRGADLLYAMVLLKLGQETEARIS
LEALRADAVARLVARRWAGGDSAEAPEEPPDLSWAIARVYHLLAEEKLCPAPMRDLAYQT
ALQTFSSGDDHRLAELQGEARDRCGWGVIRAPGSFQPLRSDRGCLPPCSVSPSGTRSLPK
PIEGLSGWSRGCSLSSSSSPASLASNLEISQSPTMPLLSQHRGCRAPSKLCEEPRAGPGP
EPPPTGCQEPADEDIALRVRERLESLGVPDGATFCEDFQVPGRGHLRCLQDAIDHSAFTL
LLLTPNFDCHLGLHQAGQSLMNSLTRHECRDCVIPFLPLESSREQLSPHPCSLLTSLVCL
VCASHMGLDPPAAARGLQAAVGRHLPLARNRSGCPAPWLRAANHLPVLPPGPPAASSLTP
SGHMGLPVNSFIRATNYRVSAPLLGTGDTTGDELVWSTF
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggcctgcacgggcccgtcgctctctggcgccttcgacattctaggtgccgcaggccag
gacaagctcttgtaccttaagcacaagctgaagacggtccaccagggctgccgaggggcg
gacctcctgtacgccatggtgcttctgaagctgggccaggagacggaggccaggatctcc
ctggaagcgctgagggcggacgcagtggcccggctcgtggcccgccgctgggccggcggg
gacagcgccgaggccccggaggagcccccagacttgtcctgggccattgcccgggtgtac
cacctgctcgccgaggagaagctgtgcccggcccctatgcgggacctggcctaccagaca
gccctccagacgttcagctccggggacgaccaccggctggccgagctccagggagaggcc
cgggaccggtgcggctggggcgtcatccgggcccccgggagcttccagccccttcgctcc
gatcggggctgcctcccgccatgctcggtgtccccctcgggcacccgcagcctgcccaag
cccatcgagggcctttcgggctggagcagaggctgttctctgagctccagcagcagcccc
gcctccctcgccagcaacctggaaatcagccagtcacccaccatgcctcttctcagccag
caccgcggctgtcgtgcgcccagcaagctgtgtgaggagccccgggcaggccccgggccc
gaacccccccccacaggctgccaggagcctgcagacgaggacattgccctgcgggtccga
gagaggctggagagcctgggcgtccccgatggcgccaccttctgcgaggatttccaggtg
cccgggcgcggccacctgcgctgcctgcaggacgccatcgaccactcagccttcaccctc
ctgctgctgacccccaacttcgactgccacctgggcctgcaccaggcgggccagtccctg
atgaacagcctcacgcggcacgagtgccgggactgcgtgatccctttcctgcccctggag
agctcgcgggagcagctcagcccccacccctgcagcctgctcaccagcctggtgtgccta
gtctgtgcgagccacatgggcctcgacccgccagctgcagccaggggcctgcaggctgcc
gtcgggcggcatctccccttggctcgaaaccgcagtggctgcccagcgccctggctgcgg
gccgccaaccacctgcctgtgctccccccgggccccccagcagcttcctccctcacccca
tcgggccacatgggcctccctgtgaattcctttattcgtgcaacaaactaccgggtgtca
gcccctcttctaggcactggggacacaacaggggacgagctggtgtggtcgacgttctag

DBGET integrated database retrieval system