KEGG   Panthera tigris altaica (Amur tiger): 102951574Help
Entry
102951574         CDS       T02988                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04217  Necroptosis
ptg04218  Cellular senescence
ptg04380  Osteoclast differentiation
ptg04640  Hematopoietic cell lineage
ptg04932  Non-alcoholic fatty liver disease (NAFLD)
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04940  Type I diabetes mellitus
ptg05020  Prion diseases
ptg05133  Pertussis
ptg05140  Leishmaniasis
ptg05152  Tuberculosis
ptg05162  Measles
ptg05164  Influenza A
ptg05321  Inflammatory bowel disease (IBD)
ptg05323  Rheumatoid arthritis
ptg05332  Graft-versus-host disease
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102951574 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102951574 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102951574 (IL1A)
   04218 Cellular senescence
    102951574 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102951574 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102951574 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102951574 (IL1A)
   05321 Inflammatory bowel disease (IBD)
    102951574 (IL1A)
   05332 Graft-versus-host disease
    102951574 (IL1A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    102951574 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102951574 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102951574 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102951574 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102951574 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102951574 (IL1A)
   05152 Tuberculosis
    102951574 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    102951574 (IL1A)
   05164 Influenza A
    102951574 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102951574 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102951574 (IL1A)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102951574 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep
Motif
Other DBs
NCBI-GeneID: 102951574
NCBI-ProteinID: XP_007082400
LinkDB All DBs
Position
Un
AA seq 270 aa AA seqDB search
MAKVPDLFEDLKNCYSENEEYNSEVDHLTLNQKSFYDASYDPLHEDCTDKFMSPSTSETS
KTSQLTLKESVVMVVANGKILKKRRLSLNQFLTADDLEAIANEVEEEIMKPRSVAPNFYS
SEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKL
PVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPK
LFIATREEKLVHMARGLPSVTDFQILETQS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttcctgacctctttgaagacctgaagaactgttacagtgaaaatgaagaa
tacaattctgaagttgaccatctcactctgaatcagaaatccttctatgatgcaagctat
gacccacttcatgaggactgtacagataaatttatgtctccgagtacttctgaaacctcc
aagacatcccagcttaccctcaaggagagtgtagtgatggtggtagccaatgggaagatt
ctgaagaagaggcggttgagtttaaatcaattcctcactgctgatgacctggaagccatt
gcaaacgaagtagaagaagaaatcatgaagcccagatcagtagcacccaacttctatagc
agtgaaaaatacaactatcagaagatcatcaaatcccaattcatcctgaatgacaacctc
agtcaaagtgtaattcgaaaagcagggggaaaatacctcgcagccgctgcattacagaat
ctggatgatgcagtgaaatttgacatgggggcttatacatcaaaagaagattctaaactt
cctgtgactctcagaatctcaaaaactcgactgtttgtgagtgctcaaaatgaagatgag
cctgtattgctaaaggagatgcctgagacacccaaaaccatcagagatgagaccaacctt
ctcttcttctgggaacgtcatggcagtaagaactacttcaaatcagttgcccatccaaag
ttgttcattgccacacgggaagaaaaactggtgcacatggcaagagggctaccctctgtc
actgactttcagatactggaaacccagtcttga

DBGET integrated database retrieval system