KEGG   Panthera tigris altaica (Amur tiger): 102951678
Entry
102951678         CDS       T02988                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04916  Melanogenesis
ptg05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102951678 (KITLG)
   04014 Ras signaling pathway
    102951678 (KITLG)
   04015 Rap1 signaling pathway
    102951678 (KITLG)
   04072 Phospholipase D signaling pathway
    102951678 (KITLG)
   04151 PI3K-Akt signaling pathway
    102951678 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102951678 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102951678 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102951678 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102951678 (KITLG)
Cytokines and growth factors [BR:ptg04052]
 Growth factors
  Growth factors (RTK binding)
   102951678 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102951678
NCBI-ProteinID: XP_015394558
LinkDB
Position
Un
AA seq 277 aa
MDLYAIHSTWIVTCIYLQLLLFNPLVKTKGLCRNRVTDDVKDVTKLVANLPKDYKIALKY
VPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEG
HSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSR
VSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFY
WKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 834 nt   +upstreamnt  +downstreamnt
atggacctatacgccatccacagcacttggattgtcacttgcatttatcttcagctgctc
ctatttaaccctctggtcaaaactaaagggctctgcaggaaccgtgtgactgatgatgtg
aaagacgttacaaaattggtggcaaatcttccaaaagactataagatagccctcaaatat
gtccccgggatggatgttttgcctagtcattgttggataagcgtgatggtggaacagttg
tcagtcagcttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaat
tattctatcatagacaaacttgtgaaaatagtggatgaccttgtggagtgcgtggaagga
cactcatctgagaatgtaaaaaaatcatctaagagcccagaacccaggctttttactcct
gaagaattctttagaatttttaatagatccattgatgccttcaaggacttggagatggtg
gcatctaaaactagtgaatgtgtggtttcttcaacattaagtcccgaaaaagattccagg
gtcagtgtcacaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgac
agcagtagcagtaataggaaggccacaaatcccatagaagactccagcatacaatgggca
gtcatggcattaccagcgtgcttttctcttgtaatcggatttgcttttggagccttctac
tggaagaagaaacaaccgaatctcacaaggacagttgaaaatatacagattaacgaagag
gataatgagataagtatgctgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system