KEGG   Panthera tigris altaica (Amur tiger): 102951788Help
Entry
102951788         CDS       T02988                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00053  Ascorbate and aldarate metabolism
ptg00071  Fatty acid degradation
ptg00260  Glycine, serine and threonine metabolism
ptg00280  Valine, leucine and isoleucine degradation
ptg00310  Lysine degradation
ptg00330  Arginine and proline metabolism
ptg00340  Histidine metabolism
ptg00380  Tryptophan metabolism
ptg00410  beta-Alanine metabolism
ptg00561  Glycerolipid metabolism
ptg00620  Pyruvate metabolism
ptg01100  Metabolic pathways
Module
ptg_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ptg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102951788 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102951788 (ALDH7A1)
   00620 Pyruvate metabolism
    102951788 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102951788 (ALDH7A1)
   00561 Glycerolipid metabolism
    102951788 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102951788 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102951788 (ALDH7A1)
   00310 Lysine degradation
    102951788 (ALDH7A1)
   00330 Arginine and proline metabolism
    102951788 (ALDH7A1)
   00340 Histidine metabolism
    102951788 (ALDH7A1)
   00380 Tryptophan metabolism
    102951788 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102951788 (ALDH7A1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102951788 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102951788 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102951788 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102951788
NCBI-ProteinID: XP_007087868
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MWRVPRQLCAHLLRGSKLSDAWNRPAAFMSTLLINQAQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWRIWAEVPAPKRGEVVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSNVLYGPLHTKQSVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHD
ASIAHTETFAPILYVFKFKSEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtgccccgccagctgtgtgcgcacctcttgaggggaagcaagctctcggac
gcttggaacaggcctgccgccttcatgtccactttgctcatcaatcaggcccagtacgct
tggctgaaggagctggggctccgcgaggaaaacgagggcgtgtataatggaagttgggga
ggccggggagaggttatcacgacttattgtcctgctaacaatgaaccaatagcaagagtc
cgacaggccagcgtggctgactatgaagaaactgtgaagaaagccagggaagcatggaga
atctgggcagaggttcctgctccgaagagaggagaagtagtgagacagattggggatgcc
ttgcgggagaagatccaagtactaggaagtttggtgtctttggagatggggaaaatctta
gtggaaggtgtaggagaagttcaagagtacgtggatatttgtgattatgctgttggctta
tcacggatgattggaggacccatcttgccttctgaaagacctggccatgccctcattgaa
cagtggaatcctgtaggcctggttggtatcatcactgcgttcaacttccctgtggcagtg
tatggctggaacaatgccattgccatgatctgtgggaatgtctgcctttggaaaggagct
ccaacaacttccctcattagtgtagctgtcacaaagataatagccaaggttctagaagac
aacaaactgcctggtgctatttgttccttgacctgtggtggagcagatataggcactgca
atggccaaagatgaacgggtgaacctgctgtccttcaccgggagcacacaggtgggaaaa
caggtggcccttatggtgcaggagaggtttgggagaagtttgttagaacttggaggaaac
aatgccatcattgcttttgaggatgcagacctcagcttggtcgttccgtcggctctcttc
gcagccgtggggacagcgggccagagatgtaccactgcacggcgcctgtttttacatgag
agcatccatgatgaagttgtaaatagacttaaaaaggcctatgcacaaatccgtgtgggg
aacccttgggactctaatgtcctctacgggccactccacaccaaacagtcagtgagcatg
tttcttggagcagtggaagaagcaaagaaagaaggtggcactgtggtctatggtggcaag
gttatggatcgccctggaaattacgtagaaccaaccattgtgacaggtctggcccacgac
gcgtccattgcccacacagaaacgtttgctccgatcctttatgtctttaaattcaagagt
gaagaagaagtgtttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaggatttgggcagaatcttccgctggcttgggccgaaaggatcagactgtggcatt
gtaaacgtcaatatcccaacgagtggggcagaaattggaggtgcatttggaggagaaaag
cacactggcggcggccgcgagtctggtagcgatgcctggaaacagtacatgagaagatct
acttgcaccatcaactacagtaaggaccttcctctagctcaaggaatcaagtttcagtaa

DBGET integrated database retrieval system