KEGG   Panthera tigris altaica (Amur tiger): 102951798
Entry
102951798         CDS       T02988                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00590  Arachidonic acid metabolism
ptg00790  Folate biosynthesis
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102951798
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102951798
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102951798
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102951798
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     102951798
    1.1.1.189  prostaglandin-E2 9-reductase
     102951798
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     102951798
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 102951798
NCBI-ProteinID: XP_007090549
LinkDB
Position
Un
AA seq 292 aa
MSSHIRVALVTGANKGIGLAIVRDLCRQFSGDVVLTARDEARGRAAVQQLQAEGLSPRFH
LLDIDDLQSIRALRDFLREEYGGLDVLVNNAGIALADGDPTPLHIQAQVTLRTNFFGTRD
MCTELLPLMKPQGRVVNVSSIMSLVALKNCSPGMQQKFRSETITEEELLELMNKFVEDTK
SGVHRKEGWPDTRALTYGVSKMGVTVLSRIYARKLSEQRRGDRILLNACCPGWVRTAMGG
PTAIKSPEEGAETPVYLALLPPDAKEPHGEFVMEKKVEQWGPPSQFPSWVPL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtcgtcacacatccgtgtagcgctggtgaccggggccaacaagggcatcggcttggcc
atcgtgcgtgacctgtgccggcagttctccggggacgtggtgctcacggcacgggacgag
gcgcggggacgggcggccgtgcagcagctccaggccgagggactgagcccccgcttccac
ctgctggacatagacgacctgcagagcatccgcgccctgcgcgacttcctgcgcgaggag
tacgggggcctggacgtgctggtcaacaacgcgggcattgctcttgctgatggtgacccc
acccccttacatattcaagcacaagtgacattgagaacaaacttctttggtactcgagac
atgtgcacagaactgctgcctctaatgaaaccacaaggcagagtggtcaatgtgtctagc
ataatgagcttagtagctcttaagaactgcagcccaggaatgcagcagaagttcagaagt
gagactatcacagaggaggagctgttggaactcatgaacaagttcgtggaagacacaaag
agtggggtacacaggaaggagggctggcctgatacgagggcactcacatatggagtgtca
aagatgggtgtcaccgtcctgtccagaatctatgccaggaaactgagtgagcagaggagg
ggagacaggatcctcctgaatgcctgctgccctgggtgggtgagaacagccatgggtgga
cctacagccattaaaagcccagaagaaggagcagagactcccgtctacttggcccttttg
cccccggatgccaaggagcctcacggggagtttgttatggagaagaaagttgaacaatgg
ggacccccctctcagttcccttcatgggtcccgttatga

KEGG   Panthera tigris altaica (Amur tiger): 102962462
Entry
102962462         CDS       T02988                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00590  Arachidonic acid metabolism
ptg00790  Folate biosynthesis
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102962462
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102962462
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102962462
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102962462
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     102962462
    1.1.1.189  prostaglandin-E2 9-reductase
     102962462
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     102962462
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_4 DUF3216
Other DBs
NCBI-GeneID: 102962462
NCBI-ProteinID: XP_015396693
LinkDB
Position
Un
AA seq 301 aa
MCSDTRVALVTGANKGIGLATVRDLCRQFSGDVVLTARDEARGRAAVQRSRAEAPVQQLQ
AEGLSPRFHLLDIDDLQSIRALRDFLRKEYGGLDVLVNNAAVFFDIGDPTPLHIQAEVTM
KTNFFGTRDVCTELLPLMRPQGRVVNVSSIMSFVALEYCSPGLQQKFRSETITEEELVGF
MNKFVDDVKNGVHQNEGWPDMKVVTYGVSEMGLTVLSRIYARKLSEQRRGDKILLNACCP
GWVRTDMGGPKGIKTIEEGAETPVYLALLPLDAKGPHGEFVMEKKVEQWGLRPQFPPWVP
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atgtgttcggacacccgcgtggcgctggtgaccggggccaacaagggcatcggcttggcc
accgtgcgtgacctgtgccggcagttctccggggacgtggtgctcacggcacgggacgag
gcgcggggacgggcggccgtgcagcggtcccgggcggaggcgcccgtgcagcagctccag
gccgagggactgagcccccgcttccacctgctggacatagacgacctgcagagcatccgc
gccctgcgcgacttcctgcgcaaggagtacgggggcctggacgtgctggtcaacaatgca
gccgtcttctttgacattggtgaccccacccccttacatattcaagcagaagtgacgatg
aaaacaaacttctttggtacccgagacgtgtgcacagaactgctgcctctaatgagaccc
caaggcagagtggtcaatgtgtctagtataatgagctttgtagctcttgaatactgcagc
ccaggactacagcagaagttcagaagtgagaccatcacagaggaggagctggtggggttc
atgaacaagtttgtggacgatgtaaagaacggagtgcaccagaacgagggctggcctgat
atgaaagtagtcacatatggagtgtcagagatgggtctcacagtcctgtccagaatctat
gccaggaaactgagtgagcagaggagaggggacaagatcctcctgaatgcctgctgccct
gggtgggtgagaacagacatgggtgggccaaaaggcatcaaaaccatagaagaaggagca
gagactcctgtctacttggcccttttgcccttggatgctaaggggcctcacggggagttt
gttatggagaagaaagttgaacaatggggactccgccctcagttccctccatgggtccca
ttatga

KEGG   Panthera tigris altaica (Amur tiger): 102963221
Entry
102963221         CDS       T02988                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00590  Arachidonic acid metabolism
ptg00790  Folate biosynthesis
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102963221
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102963221
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102963221
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102963221
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     102963221
    1.1.1.189  prostaglandin-E2 9-reductase
     102963221
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     102963221
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2
Other DBs
NCBI-GeneID: 102963221
NCBI-ProteinID: XP_007090513
LinkDB
Position
Un
AA seq 277 aa
MSSHTRVALVTGANKGIGFNIVRDLCRQFSGDVVLTARDEARGQAAGQGLQAEGLSPRFH
LLDIDDLQSIRAMRDFLRKEYGGLDVLVNNAGIAFKTNDPTPFHIQAEVTMKTNFFGTRD
VCTELLPLMKPQGRVVNVSSIVSLRSLKNCSPGLQQKFRSETITEEELVGLMNKFVEDTK
NGVHRKEGWPDTAYGVTKIGVTVLSRIHARKLSEQRRGDKILLNACCPGWVRTDMAGPRA
TKSPEEGAETPVYLALLPSDAEGPHGEFVMEKKVEQW
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtcgtcacacacccgcgtggctctggtaaccggggccaacaagggtatcggcttcaac
atcgtgcgcgacctgtgccggcagttttcgggggacgtggtgctcacggcgcgggacgag
gcgcggggacaggcggcagggcaggggctccaggccgaaggactgagcccccgcttccac
ctgctggacatagacgacctgcagagcatccgcgccatgcgcgacttcctacgcaaggag
tacgggggcctggacgtgctggtcaacaacgcgggcatcgccttcaagaccaatgatccg
acaccgtttcatattcaagcggaagtgacgatgaaaacaaacttctttggtacccgagac
gtgtgcacagaactgctgcctctaatgaaaccccaaggcagagtggtcaatgtgtctagc
atagtgagcctcagatcgcttaaaaactgcagcccaggactgcagcagaagttcagaagt
gaaaccatcacagaggaggagctggtggggctcatgaacaagttcgtggaagacacaaag
aacggggtgcacaggaaggagggctggcctgatactgcatatggagtgacaaaaattggt
gtcacggtcctgtccagaatccatgccaggaaactgagtgagcagaggagaggggacaag
atcctcctgaatgcctgctgccctgggtgggtgagaacagacatggccggacccagagcc
actaaaagcccagaagaaggagcagagacccccgtctacttggcccttttgccctcagat
gctgagggacctcacggggagtttgttatggagaagaaagtcgaacaatggtga

KEGG   Panthera tigris altaica (Amur tiger): 107180402
Entry
107180402         CDS       T02988                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00590  Arachidonic acid metabolism
ptg00790  Folate biosynthesis
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107180402
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107180402
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107180402
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107180402
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     107180402
    1.1.1.189  prostaglandin-E2 9-reductase
     107180402
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     107180402
SSDB
Motif
Pfam: adh_short adh_short_C2 KR MoCF_biosynth Fibrillin_U_N Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 107180402
NCBI-ProteinID: XP_015396694
LinkDB
Position
Un
AA seq 292 aa
MCSDTRVALVTGANKGIGLATVRDLCRQFSGDVVLTARDEARGRAAVQRLQAEGLSPRFH
LLDVDDLQSIRALRDFLRKEYGGLDVLVNNAGIALDIDDHTPLHIKAELTMKTNFFGTRN
VCTELLPLMKPQGRVVNVSSIMSFVALEYCSPGLQQKFRSETITEEELVGLMNKFVEDVK
NRVHQNEGWPDIQIPTYGVSKMGVTVLSRIYARKLSEQRRGDRILLNACCPGWVRTAMGG
PTAIKSPEEGAETPVYLALLPPDAKEPHGEFVMEKKVKQWGPPSQFPSWVPL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtgttcagacacccgcgtggcgctggtgaccggggccaacaagggcatcggcttggcc
accgtgcgtgacctgtgccggcagttctccggggacgtggtgctcacggcacgggacgag
gcgcggggacgggcggccgtgcagcggctccaggccgagggactgagcccccgcttccac
ctgctggacgtcgacgacctgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacgggggcctggacgtgctggtcaacaacgcgggcattgccctcgatattgatgatcac
acacccttacatattaaagcagaattgacaatgaaaacaaacttctttggtactcgaaac
gtgtgcacagaactgctgcctctaatgaaaccccaaggcagagtggtcaatgtgtctagt
ataatgagctttgtagctcttgaatactgtagcccaggactgcagcagaagttcagaagt
gaaaccatcacagaggaggagctggtggggctcatgaacaagtttgtggaagacgtaaag
aacagagtgcaccaaaacgagggctggcctgatatccaaatacctacatatggagtgtca
aagatgggtgtcaccgtcctgtccagaatctatgccaggaaactgagtgagcagaggagg
ggagacaggatcctcctgaatgcctgctgccctgggtgggtgagaacagccatgggtgga
cctacagccattaaaagcccagaagaaggagcagagactcccgtctacttggcccttttg
cccccggatgccaaggagcctcacggggagtttgttatggagaagaaagttaaacaatgg
ggacccccctctcagttcccttcatgggtcccgttatga

DBGET integrated database retrieval system