KEGG   Panthera tigris altaica (Amur tiger): 102951809
Entry
102951809         CDS       T02988                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04071  Sphingolipid signaling pathway
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04650  Natural killer cell mediated cytotoxicity
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102951809 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102951809 (BID)
   04215 Apoptosis - multiple species
    102951809 (BID)
   04217 Necroptosis
    102951809 (BID)
   04115 p53 signaling pathway
    102951809 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102951809 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102951809 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102951809 (BID)
   05014 Amyotrophic lateral sclerosis
    102951809 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    102951809 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102951809 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102951809 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102951809 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102951809 (BID)
   05161 Hepatitis B
    102951809 (BID)
   05160 Hepatitis C
    102951809 (BID)
   05164 Influenza A
    102951809 (BID)
   05162 Measles
    102951809 (BID)
   05168 Herpes simplex virus 1 infection
    102951809 (BID)
   05163 Human cytomegalovirus infection
    102951809 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102951809 (BID)
   05169 Epstein-Barr virus infection
    102951809 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102951809 (BID)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C DUF5631 DUF1002 bcl-2I13 TrbI_Ftype
Other DBs
NCBI-GeneID: 102951809
NCBI-ProteinID: XP_007092854
LinkDB
Position
Un
AA seq 196 aa
MDSQVSNGSSLQDERITNLLVFGFLQNCSNYNFHKELEVLGRELPVPPAYLQEDHDDGLQ
TDGNRCSRFLDSEETDSESQEEIIQDIARQLAQIGDRMDHSIHPRVVNNLAMQFMNVNLS
EEDRRKHLAAALEQVLQTYPKDMEREKTVLMLAMVLAKKVADHTPSLLRDVFRTTVNFIN
QNLLTYVRNLVRNEMD
NT seq 591 nt   +upstreamnt  +downstreamnt
atggattctcaggtcagcaatggttcaagcctccaggatgagcgcatcacaaacttgctg
gtgtttggcttcctccaaaactgctccaactataatttccataaagagttagaagtgttg
ggccgtgaactgcctgtgccaccagcttacctgcaggaggaccacgatgatgggctccag
acagatggcaaccggtgcagccgcttcctggatagcgaggagacagattctgagagtcaa
gaggaaatcatccaagatatcgccaggcagctcgcccaaatcggggataggatggatcac
agcatccacccaagagtggtgaataacctggcaatgcagtttatgaatgtgaacctgtca
gaagaagacagaaggaagcaccttgctgctgcgctggagcaggtcctacagacttacccg
aaggacatggagagggagaagaccgtgctcatgttggccatggtattggccaaaaaggtg
gccgatcacacaccgtccttgctccgtgatgtctttcgcacaacagtgaactttattaac
cagaacttactcacatatgtgaggaacttagtcagaaatgagatggactga

DBGET integrated database retrieval system