KEGG   Panthera tigris altaica (Amur tiger): 102952059
Entry
102952059         CDS       T02988                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102952059 (MYD88)
   04064 NF-kappa B signaling pathway
    102952059 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102952059 (MYD88)
   04621 NOD-like receptor signaling pathway
    102952059 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952059 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102952059 (MYD88)
   05135 Yersinia infection
    102952059 (MYD88)
   05133 Pertussis
    102952059 (MYD88)
   05134 Legionellosis
    102952059 (MYD88)
   05152 Tuberculosis
    102952059 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102952059 (MYD88)
   05161 Hepatitis B
    102952059 (MYD88)
   05171 Coronavirus disease - COVID-19
    102952059 (MYD88)
   05164 Influenza A
    102952059 (MYD88)
   05162 Measles
    102952059 (MYD88)
   05168 Herpes simplex virus 1 infection
    102952059 (MYD88)
   05169 Epstein-Barr virus infection
    102952059 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    102952059 (MYD88)
   05145 Toxoplasmosis
    102952059 (MYD88)
   05140 Leishmaniasis
    102952059 (MYD88)
   05142 Chagas disease
    102952059 (MYD88)
   05143 African trypanosomiasis
    102952059 (MYD88)
SSDB
Motif
Pfam: TIR TIR_2 Death Peptidase_S66C
Other DBs
NCBI-GeneID: 102952059
NCBI-ProteinID: XP_007081109
LinkDB
Position
Un
AA seq 287 aa
SASPIPSASSLPLAALNVRVRRRLSLFLNVRTQVAADWTALAEEMGFEYLEIRQLEAHAD
PMGKLLDDWQGRPGASVGRLLALLTQLGRASVRTRVPGLIPGDCQKYILKQQQEESEKPL
QVAAVDSSDPRTSELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIRQLEQTDYRL
KLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQ
KRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 864 nt   +upstreamnt  +downstreamnt
tccgcgtcccccatcccctcggcgtcctccctgcctctagctgccctcaacgtgcgagtg
cggcgccgcctgtcgctgttcctgaacgtgcggacgcaggtggcggccgactggacggcg
ctggctgaggagatgggcttcgagtacttggagatccggcagctggaggcgcatgccgac
cccatgggcaagctcctggacgactggcagggacgcccgggagcctcggtgggccgtctg
ctggcgctgctcacccagctcggccgcgcttcggtgaggacacgcgttcccggcctcata
ccgggggattgccagaagtatattctgaaacagcagcaggaggagtctgagaagccctta
caggtggctgctgtagatagcagtgacccacggacatcagagctggcgggcatcaccacg
cttgatgaccccttggggcaaatgccggagcgttttgatgccttcatctgctactgcccc
agcgatatccagtttgttcaggagatgatccggcagctggaacagacagattaccggctg
aagttgtgtgtgtctgatcgcgatgtcctccctggcacctgtgtctggtccatcgccagt
gagctcattgagaagaggtgccgccggatggtggtggtggtctctgatgattacctgcaa
agcaaggaatgtgacttccagactaagtttgcgctcagcctctctcccggtgcccatcag
aagcgactgatccccatcaagtacaaggcaatgaagaaagagttccccagcatcctgcgg
ttcatcactgtctgcgactacaccaacccttgcaccaagtcctggttctggacccgcctt
gccaaggccctgtccctgccctga

DBGET integrated database retrieval system