KEGG   Panthera tigris altaica (Amur tiger): 102952100
Entry
102952100         CDS       T02988                                 

Gene name
MEFV
Definition
(RefSeq) MEFV, pyrin innate immunity regulator
  KO
K12803  pyrin
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04621  NOD-like receptor signaling pathway
ptg05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102952100 (MEFV)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102952100 (MEFV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102952100 (MEFV)
Membrane trafficking [BR:ptg04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    102952100 (MEFV)
SSDB
Motif
Pfam: PYRIN PRY SPRY zf-B_box APG17 DUF3482 DUF4078 TMPIT DUF5344
Other DBs
NCBI-GeneID: 102952100
NCBI-ProteinID: XP_007073395
LinkDB
Position
Un
AA seq 859 aa
MIKTPSDHLLHSLEGLVPNDFERFKFKLQNTSLEKDQSRIPRGQLQKARPVKLATLLITH
YGEECAVRLTLQVLRAINQNFLAEELHKATDPESLIQESGADGSAMSCSSGENKPKGLRI
PDVLEGDRQRQSGDGAPSLPSSQPEAGRGTQKKPQGKRRDQKTSEGLDMLGKPGARNVTL
SCRKCPFSGKLQGERGIDPSVSLRRNDSLGRLQGLNYGSLPGSLGRTKSKINEAHLPSAQ
KRPRSLEITIFSGEREVPNPETLLSQEKMRSDNPDSAATLSEVATLNVGATVTPEKGVRN
PEHSMSLKGGAFRNTLPNVSLTRAKTTWEHPESTGPSKKNGIGGQEPPEALTEVVGGELH
EPSDPEVPPSSGKPRDEAVYVLGRAQEGDPVGGTHVRDSCRRSVASRDPKTSDSCSTSWL
QSQAPLLVKNSGDCKQQEGLQMTSLSPKALPQCERHMRQAQLLFCEDHREPICLICRLSQ
EHRGHRVRPIEEAALEYKEQIQKQLEYLKELRKSGEEQRSQGDKKTADFLKQIETRKQRI
RHQLKQLYHFLEEQEKFFMASLEELGQTIGHVRESYSTRASRDIALLNELIGEMEVKQSQ
PEWELMQDIGVTLHRAKMVTVPKPWATPPEVEKKMHLFYQKSEFVEKSMKYFSEILHSEM
DTINVPELICAQTHAVNVILDTETAHPNLIFSNDLKSVRLGNKWDRLPDSPERFDSCIIA
LGLPSFLSGRHYWEVEVGNKTGWILGICKASMSRKGNMTLSPDNGYWVVMMTKRSEFQVS
TIPPTRLQMTEPPRRVGIFLDYTTGDISFYNVTNKSVIYTFTGFSCSGPLQPIFSPGTHD
GGKNTDPLIICPVGGQGPP
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgatcaagacccctagtgaccatctgctgcactccctggaggggctggtgcccaatgac
tttgagaggttcaagtttaagctccagaacaccagcctggagaaggatcaatcccggatc
ccccggggccagctccagaaagccaggccagtgaagctggccaccctgctgatcacccac
tatggggaagagtgtgccgtgcggctgaccctgcaggtcctgagggccatcaaccagaac
ttcctggcagaggagctccacaaggcgactgacccagagtctctgatacaagaaagtggc
gcagatggttcagcaatgtcttgttcctccggggagaataagcccaaaggcctgaggata
ccagatgtcctggaaggtgacaggcagcggcaaagtggtgacggggcccccagtctgcca
tccagccagcctgaggctggaagggggacccagaagaagcctcagggaaaacggagagat
cagaagacctctgaaggcctggatatgctgggcaagccaggggctaggaacgtgactctg
tcctgcaggaaatgcccattctctggcaagctgcagggggaaagggggatcgatcccagc
gtcagtctacgcaggaatgacagcttaggaaggctccaaggactgaactatgggtcgctt
cctgggtccctaggaaggacaaaatccaaaataaatgaagcacatttaccttctgcacag
aagcgccccagaagtcttgaaattaccattttttcaggagagagagaagtccccaatcca
gaaactcttctgtctcaagagaaaatgagaagtgacaatccagactcagcagccaccctc
agtgaagtggccactctgaatgtaggggctactgtgactccagagaaaggcgttaggaat
ccagaacattccatgagcctgaaagggggagcattcaggaatacacttcccaatgtatcg
ttgactagagcaaagacgacgtgggagcatccagaatctacaggaccttctaagaaaaac
ggaattgggggtcaagaaccccctgaggccttgacagaggtggtaggcggtgagctccat
gagccttcagatccagaagttcctccttcttcagggaagccacgggatgaggctgtgtat
gtccttggccgtgcccaggaaggagacccggttggtggcacgcatgtgcgcgattcctgc
agacgctccgtggcttctagggatcccaagacctcagacagctgctcaactagctggctc
cagagccaggccccactcttggtaaagaactcaggagactgcaagcagcaggagggcctg
cagatgaccagcttgagccccaaggccctgccacagtgtgagcgacatatgaggcaggcc
cagttgctcttctgcgaggaccacagggagcctatctgcctcatctgcaggctgagtcaa
gagcaccgaggccaccgggtgcgccccatcgaggaggctgccctggaatataaggagcaa
attcaaaagcagctggagtatctgaaggagttgagaaaatctggggaggagcagagatct
cagggggataagaagaccgcggacttcctgaaacaaatcgaaacccggaagcagagaatc
cggcaccagttgaagcagctgtaccattttctggaagagcaagagaagttcttcatggcc
tccctagaggagctgggccagaccattggccacgtcagggagtcatacagcacccgagcg
tccagagacatcgcccttctcaatgagctgattggggagatggaggtcaaacagagccag
ccggaatgggagctcatgcaggacatcggagtcaccctgcacagggccaagatggtgact
gtccctaagccatgggccactcctccagaggtggaaaaaaagatgcacttgttctaccag
aaatcggagtttgtggagaagagcatgaagtacttctcggaaattctgcattcagaaatg
gacaccatcaacgttccagaactgatttgcgctcagacacatgccgttaatgtgattctg
gacacagaaactgcccaccccaatctcatcttctctaatgacctgaaaagcgtgagactt
ggaaacaagtgggatcgtctgcctgacagtccagaaagattcgatagttgcatcattgcc
ctaggccttccaagcttcctctctggccgccattattgggaagtggaggtaggaaacaag
acagggtggatcctgggtatctgcaaggcatccatgagcaggaaggggaacatgactctg
tcacctgacaatggctattgggtggtgatgatgacaaagcgaagcgaattccaggtgtcc
accattcccccaacgcgcctgcagatgacggaaccccccagacgtgtcggcatcttcctt
gattacaccaccggagacatttccttttacaatgtaacaaacaagtccgttatctacaca
ttcaccggcttctcttgctctgggccccttcagcctatcttcagccctggaacacatgat
ggagggaagaacacggatcctctgatcatctgtccagtgggtggccaggggcctccctga

DBGET integrated database retrieval system