KEGG   Panthera tigris altaica (Amur tiger): 102952137
Entry
102952137         CDS       T02988                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04072  Phospholipase D signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04613  Neutrophil extracellular trap formation
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04919  Thyroid hormone signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05012  Parkinson disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05135  Yersinia infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05214  Glioma
ptg05223  Non-small cell lung cancer
ptg05225  Hepatocellular carcinoma
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
ptg_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102952137 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102952137 (PLCG1)
   04014 Ras signaling pathway
    102952137 (PLCG1)
   04015 Rap1 signaling pathway
    102952137 (PLCG1)
   04370 VEGF signaling pathway
    102952137 (PLCG1)
   04064 NF-kappa B signaling pathway
    102952137 (PLCG1)
   04066 HIF-1 signaling pathway
    102952137 (PLCG1)
   04020 Calcium signaling pathway
    102952137 (PLCG1)
   04070 Phosphatidylinositol signaling system
    102952137 (PLCG1)
   04072 Phospholipase D signaling pathway
    102952137 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102952137 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    102952137 (PLCG1)
   04660 T cell receptor signaling pathway
    102952137 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    102952137 (PLCG1)
   04659 Th17 cell differentiation
    102952137 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    102952137 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    102952137 (PLCG1)
   04670 Leukocyte transendothelial migration
    102952137 (PLCG1)
   04062 Chemokine signaling pathway
    102952137 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102952137 (PLCG1)
   04919 Thyroid hormone signaling pathway
    102952137 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102952137 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102952137 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    102952137 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952137 (PLCG1)
   05206 MicroRNAs in cancer
    102952137 (PLCG1)
   05205 Proteoglycans in cancer
    102952137 (PLCG1)
   05231 Choline metabolism in cancer
    102952137 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952137 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102952137 (PLCG1)
   05214 Glioma
    102952137 (PLCG1)
   05223 Non-small cell lung cancer
    102952137 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102952137 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    102952137 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102952137 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102952137 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102952137 (PLCG1)
   05171 Coronavirus disease - COVID-19
    102952137 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952137 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102952137 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102952137 (PLCG1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102952137 (PLCG1)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102952137 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102952137 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 GDPD PH_9
Other DBs
NCBI-GeneID: 102952137
NCBI-ProteinID: XP_007077781
LinkDB
Position
Un
AA seq 1179 aa
MEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRI
SAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPF
LEASALRAVERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPY
FFLDEFVTFLFSKENSVWNSQLDAVCPETMNNPLSHYWISSSHNTYLTGDQFSSESSLEA
YARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILS
IEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAY
EEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDE
EEPKEASGSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFV
GDYTLSFWRNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMR
LSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKI
KHCRVQQEGQTVVLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYG
ALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGD
YGGKKQLWFPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNN
RLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALE
LSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIY
PKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDE
AFDPFDKSSLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVV
DNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKAGYRAVPL
KNNYSEDLELASLLIKIEVFPAKQENGDVSPFSSMSLRERGSDASGQLFHGRGREGSFEA
RYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggagttccgcctgaagaccctgagcctgcaagctacatctgaggatgaagtgaacatg
tggatcaaggggttaacttggctgatggaagatacattgcaggcagccacacctctgcag
attgaaaggtggctgaggaagcagttctattcggtggatcggaatcgtgaggatcgtata
tcagccaaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgc
ttcctccgagagcgtctgacggacctggagcagcgcagcagtgacatcacctatgggcag
tttgctcagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttc
ttggaagccagtgccctgagggcggtggagcggccggagctctgtcgcgtgtcccttcct
gagttccagcagttcctccttgagtaccagggggagctgtgggccgtcgaccggcttcag
gtgcaagaatttatgctcagctttctccgagaccccttgcgagagattgaagagccgtac
ttcttcctggatgagtttgtcaccttcctgttctccaaagagaacagtgtgtggaactca
cagctggatgcagtgtgcccagaaaccatgaacaaccccctctcccactactggatctcc
tcctcccacaacacatacctgaccggggaccagttctccagcgagtcctccctggaagcc
tacgctcgctgcctgcggatgggctgtcgctgcattgagttggactgctgggatggccca
gatgggatgccagtcatttaccatggacacacccttaccaccaagatcaagttctcagac
gtcctgcacactatcaaggagcacgcctttgtggcctcagagtacccggtcatcctgtcc
attgaggaccattgcagcattgcccagcagaggaacatggcacagtacttcaagaaggtg
cttggggacacactccttaccaagcctgtggacatcgctgccgatggactcccctcaccc
aaccagctcaagaggaagatccttatcaagcacaagaagctggcagagggcagtgcctat
gaagaggtgcctacatcagtgatgtactccgagaacgatatcagcaactccatcaagaat
ggcatcctctacctggaggaccctgtgaaccacgagtggtatccccactacttcgtcctg
accagcagcaaaatctactactctgaggagacgagcagtgaccagggcaacgaggatgag
gaggagcccaaggaggccagtggcagcacagagctgcactccagtgagaaatggttccac
gggaagctcggggcaggacgggatgggcggcacatcgctgagcgcctgcttaccgagtac
tgcattgagaccggggcccctgatggctccttcctcgtgcgagagagcgagaccttcgtg
ggcgactataccctctctttctggcggaatgggaaagtccagcactgccggatccactct
cggcaggacgctggggcccccaagttcttcttgacagacaacctggtctttgactcactc
tatgacctcatcacacactaccagcaggtgcccctacgctgcaacgaatttgagatgcgc
ctctcagagccagtcccgcagaccaatgcccacgagagcaaagagtggtaccatgccagc
ctgaccagagctcaggctgagcacatgctgatgcgcgtcccccgggatggggccttcctg
gtgaggaaacggaatgagcccaactcctacgccatctccttccgggctgagggcaagatc
aagcattgccgcgtccagcaggagggccagacggtggtcctgggcaactccgagttcgac
agcctcgtggacctcatcagctactatgagaagcacccactgtaccgcaagatgaagctg
cgctatcccatcaacgaggaggcgctggagaagatcggcacagctgagccagactacggg
gccctgtatgagggccgcaacccaggcttctatgtggaggcgaatcctatgccaactttc
aagtgtgcagtcaaagcactctttgactacaaggcccagagagaggatgagctgactttc
actaagagcgccatcatccagaacgtggagaagcaagaaggtggctggtggcggggggac
tatggtgggaagaagcagctgtggttcccgtcaaactacgtggaagagatggtcagcccc
gcagccctggagcctgagagggagcacttggacgagaacagccccttgggggatttgctc
cggggggtcttggatgtgccagcttgtcagattgccatccgtcccgagggcaagaacaac
cggctgttcgtcttctccatcagtatggcttccgtggcgcactggtccctggatgtcgct
gctgactcacaagaggagctgcaggactgggtgaagaagatccgagaagtggcccagacg
gcagacgccaggctcacggagggcaagatgatggagcggaggaagaagatcgccctggag
ctctccgagctggttgtctactgtcggcctgttcccttcgatgaagagaagattggcaca
gaacgtgcctgctaccgggacatgtcatccttcccggaaaccaaggctgagaaatacgtg
aacaaggccaaaggcaagaagtttctccagtacaaccggctgcagctctcccgcatctac
cccaagggccagcggctggactcttccaattacgaccccttgcccatgtggatctgtggc
agtcagctcgtggctctcaacttccagaccccagacaagcctatgcagatgaaccaggcc
ctcttcatggccggtggccactgtggctacgtgctgcagccgagcaccatgcgggatgag
gcctttgatccctttgacaagagcagcctccgaggcctggagccatatgccatctgcatt
gaggtgctgggggcccggcacctgccgaagaatggccgaggcatcgtgtgtccttttgtg
gagattgaggtggccggagcagagtatgacagcatcaaacagaagacagaatttgtggtg
gacaacggactgaaccctgtttggcccgccaagcccttccacttccagatcagtaacccg
gaattcgccttcctgcgctttgtggtgtatgaggaggacatgttcagtgaccagaacttc
ctggctcaggccaccttcccagtgaagggcttgaaggcaggatacagagccgtgcctttg
aagaacaactacagtgaggacctggagctggcctccctgctcatcaagatcgaagttttc
cctgccaagcaggagaacggtgacgtcagtcccttcagtagtatgtctctgcgggagcgg
ggctccgatgcctcgggccagctgttccatggccggggccgggaaggttcctttgaagcc
cgctaccagcagccgtttgaggactttcgtatctcccaagagcatctggcagaccatttt
gacagtcgggaacggagggccccacgaaggactcgggtcaacggggacaaccgcctctag

DBGET integrated database retrieval system