KEGG   Panthera tigris altaica (Amur tiger): 102952498
Entry
102952498         CDS       T02988                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04066  HIF-1 signaling pathway
ptg04217  Necroptosis
ptg04380  Osteoclast differentiation
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05200  Pathways in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102952498 (IFNGR1)
   04066 HIF-1 signaling pathway
    102952498 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102952498 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102952498 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102952498 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    102952498 (IFNGR1)
   04659 Th17 cell differentiation
    102952498 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102952498 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952498 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952498 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102952498 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102952498 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    102952498 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    102952498 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952498 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102952498 (IFNGR1)
   05140 Leishmaniasis
    102952498 (IFNGR1)
   05142 Chagas disease
    102952498 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102952498 (IFNGR1)
   04090 CD molecules [BR:ptg04090]
    102952498 (IFNGR1)
Cytokine receptors [BR:ptg04050]
 Interleukin receptor families
  IFN receptor family
   102952498 (IFNGR1)
CD molecules [BR:ptg04090]
 Proteins
  102952498 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Comm Shisa Cadherin_C_2 TMIE
Other DBs
NCBI-GeneID: 102952498
NCBI-ProteinID: XP_015399383
LinkDB
Position
Un
AA seq 468 aa
MLVIKRIQDYYYNSFLQLPILLFESLTVPKPTNIEIKAYNFNTVLSWDYPTMSQTPVFIV
QVKNYGEAIWVDACNTSHHSCNIFSAITDPSLSLWARIKARLGQKESAYAESKEFILCKQ
GKIGPPELGIRNMEKHVIIDVFHPLAIISGREPVAIYGEENCYSFKYEVHLRINGNETSY
KTDVEEDNCNETQCYLTVPVSSLDSEYCAWTKGFSETWLVTTEQSKELCVTTLDGKHMED
SVWVPVVAVLFLFVVLVVVFVCCYTKKINPFKRRTIMLPKSLLSVVKNASSETKSESKCV
SPITYQPIVSENEKMVWEEQLSPATISDLPAEDSLEKMGHHEELQVVTPEGTISDMAPDS
PQTPVMRENSVRSNSNQSETCVVALNSYHSRNGSESGTVESQSFSDSEFPPSSKPEIKTE
EQEPVMLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYRLTADSKEFS
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgctagtgattaaacgaattcaggattattattacaacagtttcttacaattgcccatt
ttactttttgaatctcttacagtgccaaaaccaacgaatattgaaattaaggcctataac
tttaatactgtcctatcttgggactacccgaccatgtcacagacccctgtttttatcgta
caggtaaagaactatggggaggcaatctgggttgatgcctgcaatacctctcatcattct
tgtaatatcttttccgcaattaccgatccatcactttctctctgggccagaattaaagct
agacttggacaaaaagaatcagcctatgcagagtccaaagaatttattttgtgtaaacaa
gggaaaattggaccacctgaactgggcatcagaaacatggaaaaacacgtcattattgac
gtatttcaccctttagctattataagtggaagggagccagtagccatatatggtgaagaa
aattgttactcattcaagtacgaggtacatctgagaataaatggaaatgagacctcatat
aaaacggatgtagaggaagataattgcaatgagactcagtgctatctaactgtcccagtg
tcctcgttggattctgagtactgtgcttggacaaaaggattctcagaaacatggcttgtt
acaactgaacagtccaaagaactttgtgttaccactttggatggcaaacacatggaagat
tctgtttgggttccagttgttgccgttctcttcctttttgtagttctcgtcgtggtattt
gtatgttgttacactaagaagattaatccctttaagagaagaaccatcatgttaccaaag
tccctgctctctgtggtgaaaaatgcctcttcggagacaaaatctgaatcgaaatgtgta
tcacccatcacctaccaaccgattgtctcagaaaatgagaagatggtctgggaagagcag
ttgtctccagcgacgatttcagatctgcccgctgaagacagtctggaaaaaatgggacac
cacgaagaactacaagtggtgacccctgaagggactatttctgacatggctcctgatagc
cctcagaccccggtaatgagagagaattctgtccgttcaaatagtaaccagtctgaaacc
tgtgttgtcgctttaaactcctatcactccagaaatggttccgagagtggcactgtggaa
tcacagagcttctcggactcagaatttcccccaagtagtaagcctgaaataaagaccgag
gaacaggagcccgtaatgctgagaaacacgaccacctcctttggttatgacaagccgcac
gtattagtggatctgctggtggatgaaggcggtaaggaatccttgattggttacagactt
acagcagattccaaagagttttcctga

KEGG   Panthera tigris altaica (Amur tiger): 102955729
Entry
102955729         CDS       T02988                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04066  HIF-1 signaling pathway
ptg04217  Necroptosis
ptg04380  Osteoclast differentiation
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05200  Pathways in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102955729 (IFNGR2)
   04066 HIF-1 signaling pathway
    102955729 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102955729 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102955729 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102955729 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    102955729 (IFNGR2)
   04659 Th17 cell differentiation
    102955729 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102955729 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102955729 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102955729 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102955729 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102955729 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    102955729 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    102955729 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102955729 (IFNGR2)
   05140 Leishmaniasis
    102955729 (IFNGR2)
   05142 Chagas disease
    102955729 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102955729 (IFNGR2)
Cytokine receptors [BR:ptg04050]
 Interleukin receptor families
  IFN receptor family
   102955729 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 102955729
NCBI-ProteinID: XP_007090487
LinkDB
Position
Un
AA seq 390 aa
MMPNLVKGGGEGTCLERHVIPFLHLDRNGVAYEWFDDVHLNIFVIDLSPFLSPPLPPSLV
LCPFQDSLSQLPAPRNPKVRLHNAEQVLSWEPVSLSNDTRPVVYQVQHKYRSSSTWYDLS
DKVEVKCMNITTTECDFTPKGNSVFLRPEFDTFLRVRAKVDELVSPWLTVPSFQYCRNVT
VGPPENIWVTPGEGSLIIRLSSPFDVRAFSATFLYYVHYWEKAGIQQVKGPFRSTSIVLN
DLKPLREYCLQIKAQLVCEKGNISRPGHLSNVSCYKTAMDAATKLQQIIVIAVGLFLFLS
MLAGACFFLVLKYRGLVKYWFHSPPSIPLQIEEYLKDPAQPILEALDKDSSPKDDAWDSV
SVVSFPEKEQEDVLHSTLHQSPGPVQQPVG
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgatgccaaatttagtcaaaggtgggggtgaggggacatgcctagagagacacgtaata
ccatttctgcacttggacagaaacggagttgcatacgaatggtttgatgacgtgcactta
aatatttttgtaatcgatctttctccctttctctctccccctcttcccccttctcttgtt
ctctgcccctttcaagactctctttcccagctgcctgctcctcgaaacccgaaggttcgc
ctgcacaatgccgagcaggttctgagttgggagccggtgtccctgagcaatgacacgagg
ccggtggtctaccaggtgcagcataaataccgtagtagcagtacgtggtatgacctcagt
gacaaggtggaggtaaagtgtatgaacatcaccacaacagagtgtgacttcaccccaaaa
ggcaactcagtctttctgcgaccggaattcgacacctttttacgtgttcgagcgaaggta
gacgagctggtctctccgtggctgacagtgccttctttccagtactgtaggaatgttacc
gtcgggcctcccgaaaacatttgggtgacgccaggagaaggctcccttatcatcaggctc
tcctctccctttgacgtccgtgccttctcggccacttttttgtattatgtccattactgg
gaaaaggcaggaatccaacaggttaaaggccctttcaggagcacctccatcgtgttgaat
gacttgaaacccttaagagaatactgtttacaaatcaaagcgcaactggtttgtgaaaaa
ggaaacatctctagacccggacacttaagcaacgtatcttgctacaaaacagcgatggat
gccgccacaaaactccagcaaatcatcgtgattgctgtgggactctttctgttcctgtcg
atgctggcgggggcctgtttcttcctggtcctgaaatacagaggcctggtgaaatactgg
tttcactctccaccgagcatcccgttacaaatagaagagtatttaaaggacccggctcag
cctatcttggaggccctggacaaggacagctcgccaaaggatgatgcctgggactctgtg
tccgttgtttcgtttccagagaaggagcaagaagatgttctccacagtactttgcaccaa
agccccggtccggtccagcagcctgtgggatga

DBGET integrated database retrieval system