KEGG   Panthera tigris altaica (Amur tiger): 102952555
Entry
102952555         CDS       T02988                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04144  Endocytosis
ptg04150  mTOR signaling pathway
ptg04270  Vascular smooth muscle contraction
ptg04310  Wnt signaling pathway
ptg04350  TGF-beta signaling pathway
ptg04360  Axon guidance
ptg04510  Focal adhesion
ptg04520  Adherens junction
ptg04530  Tight junction
ptg04611  Platelet activation
ptg04621  NOD-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04810  Regulation of actin cytoskeleton
ptg04921  Oxytocin signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04972  Pancreatic secretion
ptg05100  Bacterial invasion of epithelial cells
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05152  Tuberculosis
ptg05163  Human cytomegalovirus infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102952555 (RHOA)
   04015 Rap1 signaling pathway
    102952555 (RHOA)
   04310 Wnt signaling pathway
    102952555 (RHOA)
   04350 TGF-beta signaling pathway
    102952555 (RHOA)
   04072 Phospholipase D signaling pathway
    102952555 (RHOA)
   04071 Sphingolipid signaling pathway
    102952555 (RHOA)
   04024 cAMP signaling pathway
    102952555 (RHOA)
   04022 cGMP-PKG signaling pathway
    102952555 (RHOA)
   04150 mTOR signaling pathway
    102952555 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102952555 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102952555 (RHOA)
   04520 Adherens junction
    102952555 (RHOA)
   04530 Tight junction
    102952555 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102952555 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102952555 (RHOA)
   04621 NOD-like receptor signaling pathway
    102952555 (RHOA)
   04625 C-type lectin receptor signaling pathway
    102952555 (RHOA)
   04660 T cell receptor signaling pathway
    102952555 (RHOA)
   04670 Leukocyte transendothelial migration
    102952555 (RHOA)
   04062 Chemokine signaling pathway
    102952555 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102952555 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    102952555 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102952555 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    102952555 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102952555 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    102952555 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952555 (RHOA)
   05206 MicroRNAs in cancer
    102952555 (RHOA)
   05205 Proteoglycans in cancer
    102952555 (RHOA)
   05203 Viral carcinogenesis
    102952555 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102952555 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102952555 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102952555 (RHOA)
   05135 Yersinia infection
    102952555 (RHOA)
   05133 Pertussis
    102952555 (RHOA)
   05152 Tuberculosis
    102952555 (RHOA)
   05100 Bacterial invasion of epithelial cells
    102952555 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102952555 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102952555 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102952555 (RHOA)
   04031 GTP-binding proteins [BR:ptg04031]
    102952555 (RHOA)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    102952555 (RHOA)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102952555 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   102952555 (RHOA)
  Exosomal proteins of colorectal cancer cells
   102952555 (RHOA)
  Exosomal proteins of bladder cancer cells
   102952555 (RHOA)
GTP-binding proteins [BR:ptg04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    102952555 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 102952555
NCBI-ProteinID: XP_007088576
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc
ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacaccgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtgaaa
ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system