Panthera tigris altaica (Amur tiger): 102952555 Help Entry 102952555         CDS       T02988                                  Gene name RHOA Definition (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04022   cGMP-PKG signaling pathway ptg04024   cAMP signaling pathway ptg04062   Chemokine signaling pathway ptg04071   Sphingolipid signaling pathway ptg04072   Phospholipase D signaling pathway ptg04144   Endocytosis ptg04150   mTOR signaling pathway ptg04270   Vascular smooth muscle contraction ptg04310   Wnt signaling pathway ptg04350   TGF-beta signaling pathway ptg04360   Axon guidance ptg04510   Focal adhesion ptg04520   Adherens junction ptg04530   Tight junction ptg04611   Platelet activation ptg04621   NOD-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04660   T cell receptor signaling pathway ptg04670   Leukocyte transendothelial migration ptg04722   Neurotrophin signaling pathway ptg04810   Regulation of actin cytoskeleton ptg04921   Oxytocin signaling pathway ptg04928   Parathyroid hormone synthesis, secretion and action ptg04972   Pancreatic secretion ptg05100   Bacterial invasion of epithelial cells ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05152   Tuberculosis ptg05163   Human cytomegalovirus infection ptg05200   Pathways in cancer ptg05203   Viral carcinogenesis ptg05205   Proteoglycans in cancer ptg05206   MicroRNAs in cancer ptg05210   Colorectal cancer ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102952555 (RHOA)    04015 Rap1 signaling pathway     102952555 (RHOA)    04310 Wnt signaling pathway     102952555 (RHOA)    04350 TGF-beta signaling pathway     102952555 (RHOA)    04072 Phospholipase D signaling pathway     102952555 (RHOA)    04071 Sphingolipid signaling pathway     102952555 (RHOA)    04024 cAMP signaling pathway     102952555 (RHOA)    04022 cGMP-PKG signaling pathway     102952555 (RHOA)    04150 mTOR signaling pathway     102952555 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102952555 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102952555 (RHOA)    04520 Adherens junction     102952555 (RHOA)    04530 Tight junction     102952555 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102952555 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102952555 (RHOA)    04621 NOD-like receptor signaling pathway     102952555 (RHOA)    04625 C-type lectin receptor signaling pathway     102952555 (RHOA)    04660 T cell receptor signaling pathway     102952555 (RHOA)    04670 Leukocyte transendothelial migration     102952555 (RHOA)    04062 Chemokine signaling pathway     102952555 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102952555 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102952555 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102952555 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102952555 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102952555 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102952555 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102952555 (RHOA)    05206 MicroRNAs in cancer     102952555 (RHOA)    05205 Proteoglycans in cancer     102952555 (RHOA)    05203 Viral carcinogenesis     102952555 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102952555 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102952555 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102952555 (RHOA)    05135 Yersinia infection     102952555 (RHOA)    05133 Pertussis     102952555 (RHOA)    05152 Tuberculosis     102952555 (RHOA)    05100 Bacterial invasion of epithelial cells     102952555 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102952555 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102952555 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102952555 (RHOA)    04031 GTP-binding proteins [BR:ptg04031]     102952555 (RHOA) Membrane trafficking [BR:ptg04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102952555 (RHOA) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102952555 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102952555 (RHOA)   Exosomal proteins of colorectal cancer cells    102952555 (RHOA)   Exosomal proteins of bladder cancer cells    102952555 (RHOA) GTP-binding proteins [BR:ptg04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102952555 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  102952555 NCBI-ProteinID:  XP_007088576 LinkDB All DBs Position Un AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system