KEGG   Panthera tigris altaica (Amur tiger): 102952603
Entry
102952603         CDS       T02988                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04370  VEGF signaling pathway
ptg04371  Apelin signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04728  Dopaminergic synapse
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04922  Glucagon signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102952603 (AKT3)
   04012 ErbB signaling pathway
    102952603 (AKT3)
   04014 Ras signaling pathway
    102952603 (AKT3)
   04015 Rap1 signaling pathway
    102952603 (AKT3)
   04370 VEGF signaling pathway
    102952603 (AKT3)
   04371 Apelin signaling pathway
    102952603 (AKT3)
   04630 JAK-STAT signaling pathway
    102952603 (AKT3)
   04668 TNF signaling pathway
    102952603 (AKT3)
   04066 HIF-1 signaling pathway
    102952603 (AKT3)
   04068 FoxO signaling pathway
    102952603 (AKT3)
   04072 Phospholipase D signaling pathway
    102952603 (AKT3)
   04071 Sphingolipid signaling pathway
    102952603 (AKT3)
   04024 cAMP signaling pathway
    102952603 (AKT3)
   04022 cGMP-PKG signaling pathway
    102952603 (AKT3)
   04151 PI3K-Akt signaling pathway
    102952603 (AKT3)
   04152 AMPK signaling pathway
    102952603 (AKT3)
   04150 mTOR signaling pathway
    102952603 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102952603 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102952603 (AKT3)
   04218 Cellular senescence
    102952603 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102952603 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102952603 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102952603 (AKT3)
   04613 Neutrophil extracellular trap formation
    102952603 (AKT3)
   04620 Toll-like receptor signaling pathway
    102952603 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102952603 (AKT3)
   04660 T cell receptor signaling pathway
    102952603 (AKT3)
   04662 B cell receptor signaling pathway
    102952603 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102952603 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102952603 (AKT3)
   04062 Chemokine signaling pathway
    102952603 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102952603 (AKT3)
   04922 Glucagon signaling pathway
    102952603 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102952603 (AKT3)
   04920 Adipocytokine signaling pathway
    102952603 (AKT3)
   04929 GnRH secretion
    102952603 (AKT3)
   04915 Estrogen signaling pathway
    102952603 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102952603 (AKT3)
   04917 Prolactin signaling pathway
    102952603 (AKT3)
   04926 Relaxin signaling pathway
    102952603 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102952603 (AKT3)
   04919 Thyroid hormone signaling pathway
    102952603 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102952603 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102952603 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102952603 (AKT3)
   04728 Dopaminergic synapse
    102952603 (AKT3)
   04722 Neurotrophin signaling pathway
    102952603 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102952603 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102952603 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102952603 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952603 (AKT3)
   05205 Proteoglycans in cancer
    102952603 (AKT3)
   05230 Central carbon metabolism in cancer
    102952603 (AKT3)
   05231 Choline metabolism in cancer
    102952603 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952603 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102952603 (AKT3)
   05212 Pancreatic cancer
    102952603 (AKT3)
   05225 Hepatocellular carcinoma
    102952603 (AKT3)
   05226 Gastric cancer
    102952603 (AKT3)
   05214 Glioma
    102952603 (AKT3)
   05221 Acute myeloid leukemia
    102952603 (AKT3)
   05220 Chronic myeloid leukemia
    102952603 (AKT3)
   05218 Melanoma
    102952603 (AKT3)
   05211 Renal cell carcinoma
    102952603 (AKT3)
   05215 Prostate cancer
    102952603 (AKT3)
   05213 Endometrial cancer
    102952603 (AKT3)
   05224 Breast cancer
    102952603 (AKT3)
   05222 Small cell lung cancer
    102952603 (AKT3)
   05223 Non-small cell lung cancer
    102952603 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102952603 (AKT3)
   05017 Spinocerebellar ataxia
    102952603 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102952603 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102952603 (AKT3)
   04931 Insulin resistance
    102952603 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102952603 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102952603 (AKT3)
   05135 Yersinia infection
    102952603 (AKT3)
   05152 Tuberculosis
    102952603 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102952603 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102952603 (AKT3)
   05161 Hepatitis B
    102952603 (AKT3)
   05160 Hepatitis C
    102952603 (AKT3)
   05164 Influenza A
    102952603 (AKT3)
   05162 Measles
    102952603 (AKT3)
   05168 Herpes simplex virus 1 infection
    102952603 (AKT3)
   05163 Human cytomegalovirus infection
    102952603 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952603 (AKT3)
   05169 Epstein-Barr virus infection
    102952603 (AKT3)
   05165 Human papillomavirus infection
    102952603 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102952603 (AKT3)
   05142 Chagas disease
    102952603 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102952603 (AKT3)
   01524 Platinum drug resistance
    102952603 (AKT3)
   01522 Endocrine resistance
    102952603 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102952603 (AKT3)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102952603 (AKT3)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102952603 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 102952603
NCBI-ProteinID: XP_007077032
LinkDB
Position
Un
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDGVDSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccgagatacttccttttgaagacagatggctcattcattggatataaagag
aagcctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagagtggacagaa
gctattcaggctgtagcagacaggcttcagagacaagaagaggagagaatgaattgcagt
ccaacttcacaaattgataacataggggaggaagagatggacgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttgga
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcacacactctcactgagagcagagtgtta
aagaacactagacacccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggattacagatgcg
gccaccatgaagacgttctgtggaacaccagaatatctggcaccagaggtattagaagac
aatgactatggccgagccgtggattggtggggactaggggtcgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttcctcggacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
aggcacagtttcttttctggagttaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgacgaggacggcatggacggtgtg
gacagcgagcggcggccacatttccctcagttctcctactcggccagcggccgggaataa

KEGG   Panthera tigris altaica (Amur tiger): 102954757
Entry
102954757         CDS       T02988                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04370  VEGF signaling pathway
ptg04371  Apelin signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04728  Dopaminergic synapse
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04922  Glucagon signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102954757 (AKT2)
   04012 ErbB signaling pathway
    102954757 (AKT2)
   04014 Ras signaling pathway
    102954757 (AKT2)
   04015 Rap1 signaling pathway
    102954757 (AKT2)
   04370 VEGF signaling pathway
    102954757 (AKT2)
   04371 Apelin signaling pathway
    102954757 (AKT2)
   04630 JAK-STAT signaling pathway
    102954757 (AKT2)
   04668 TNF signaling pathway
    102954757 (AKT2)
   04066 HIF-1 signaling pathway
    102954757 (AKT2)
   04068 FoxO signaling pathway
    102954757 (AKT2)
   04072 Phospholipase D signaling pathway
    102954757 (AKT2)
   04071 Sphingolipid signaling pathway
    102954757 (AKT2)
   04024 cAMP signaling pathway
    102954757 (AKT2)
   04022 cGMP-PKG signaling pathway
    102954757 (AKT2)
   04151 PI3K-Akt signaling pathway
    102954757 (AKT2)
   04152 AMPK signaling pathway
    102954757 (AKT2)
   04150 mTOR signaling pathway
    102954757 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102954757 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102954757 (AKT2)
   04218 Cellular senescence
    102954757 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102954757 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102954757 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102954757 (AKT2)
   04613 Neutrophil extracellular trap formation
    102954757 (AKT2)
   04620 Toll-like receptor signaling pathway
    102954757 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102954757 (AKT2)
   04660 T cell receptor signaling pathway
    102954757 (AKT2)
   04662 B cell receptor signaling pathway
    102954757 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102954757 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102954757 (AKT2)
   04062 Chemokine signaling pathway
    102954757 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102954757 (AKT2)
   04922 Glucagon signaling pathway
    102954757 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102954757 (AKT2)
   04920 Adipocytokine signaling pathway
    102954757 (AKT2)
   04929 GnRH secretion
    102954757 (AKT2)
   04915 Estrogen signaling pathway
    102954757 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102954757 (AKT2)
   04917 Prolactin signaling pathway
    102954757 (AKT2)
   04926 Relaxin signaling pathway
    102954757 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102954757 (AKT2)
   04919 Thyroid hormone signaling pathway
    102954757 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102954757 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102954757 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102954757 (AKT2)
   04728 Dopaminergic synapse
    102954757 (AKT2)
   04722 Neurotrophin signaling pathway
    102954757 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102954757 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102954757 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102954757 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102954757 (AKT2)
   05205 Proteoglycans in cancer
    102954757 (AKT2)
   05230 Central carbon metabolism in cancer
    102954757 (AKT2)
   05231 Choline metabolism in cancer
    102954757 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102954757 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102954757 (AKT2)
   05212 Pancreatic cancer
    102954757 (AKT2)
   05225 Hepatocellular carcinoma
    102954757 (AKT2)
   05226 Gastric cancer
    102954757 (AKT2)
   05214 Glioma
    102954757 (AKT2)
   05221 Acute myeloid leukemia
    102954757 (AKT2)
   05220 Chronic myeloid leukemia
    102954757 (AKT2)
   05218 Melanoma
    102954757 (AKT2)
   05211 Renal cell carcinoma
    102954757 (AKT2)
   05215 Prostate cancer
    102954757 (AKT2)
   05213 Endometrial cancer
    102954757 (AKT2)
   05224 Breast cancer
    102954757 (AKT2)
   05222 Small cell lung cancer
    102954757 (AKT2)
   05223 Non-small cell lung cancer
    102954757 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102954757 (AKT2)
   05017 Spinocerebellar ataxia
    102954757 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102954757 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102954757 (AKT2)
   04931 Insulin resistance
    102954757 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102954757 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102954757 (AKT2)
   05135 Yersinia infection
    102954757 (AKT2)
   05152 Tuberculosis
    102954757 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102954757 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102954757 (AKT2)
   05161 Hepatitis B
    102954757 (AKT2)
   05160 Hepatitis C
    102954757 (AKT2)
   05164 Influenza A
    102954757 (AKT2)
   05162 Measles
    102954757 (AKT2)
   05168 Herpes simplex virus 1 infection
    102954757 (AKT2)
   05163 Human cytomegalovirus infection
    102954757 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102954757 (AKT2)
   05169 Epstein-Barr virus infection
    102954757 (AKT2)
   05165 Human papillomavirus infection
    102954757 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102954757 (AKT2)
   05142 Chagas disease
    102954757 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102954757 (AKT2)
   01524 Platinum drug resistance
    102954757 (AKT2)
   01522 Endocrine resistance
    102954757 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102954757 (AKT2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102954757 (AKT2)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102954757 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 102954757
NCBI-ProteinID: XP_007087285
LinkDB
Position
Un
AA seq 478 aa
MNEVSVIKEGWLHKRGEYIKTWRPRLKSDGSFIGYKERPGAPDQTLPPLNNFSVAECQLM
KTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPMDYK
CGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAMKIL
RKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSR
ERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISD
GATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELIL
MEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSVNWQDVVQKKLL
PPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIRE
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggagaccccggctgaagagtgacggctccttcatcggatacaaggagcggcctggt
gccccagaccagaccctgccccccctaaacaacttctctgtcgcagagtgccagctgatg
aagactgagagaccacggcccaacaccttcgtcatacgctgcctacagtggaccactgtc
atcgagaggaccttccacgtagactctccagacgagagggaggagtggatgcgggccatt
cagatggtcgccaacagccttaagcagcggggcccaggtgaggaccccatggactataag
tgtggctcccccagtgacccttctgcggccgaggagatggaagtggcagttagcaaggct
cgggccaaggtgaccatgaatgacttcgactatctcaaacttctgggcaagggcaccttt
ggcaaagtgattctggtgcgggagaaagccagcggccgctactacgccatgaagatcctg
cggaaggaagttatcattgccaaggatgaagttgcccacacagtcaccgagagccgggtc
ctccagaacaccaggcacccattcctcactgcactgaagtatgccttccagacccacgac
cgcctgtgcttcgtgatggaatacgccaacggtggtgagctgtttttccacctgtcccgg
gaacgtgtcttcacggaggagcgagcccgcttctatggtgcagagatcgtctctgccctt
gagtatttgcattcgcgggacgtggtgtaccgcgacatcaagctggaaaacctcatgctg
gacaaagatggccacatcaagatcactgacttcggactgtgcaaagagggcatcagtgac
ggggctaccatgaaaaccttctgtgggacgcccgagtacctggcacccgaggtgctggag
gacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatgtacgagatg
atgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgagctcatcctc
atggaggagatccgtttcccacgcacactgagccctgaggccaagtccctgcttgctggg
ctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgatgccagggaggtc
atggagcacaggttcttcctcagcgtcaactggcaggacgtggtgcagaagaagctcctg
ccacccttcaaacctcaggtcacctctgaggttgacacaaggtactttgacgacgagttc
accgcccagtccattacaatcacacccccggaccgctatgacagcctgggctccctcgaa
ctggaccagcggacccacttcccccagttctcctactcagccagcatccgcgagtga

DBGET integrated database retrieval system