KEGG   Panthera tigris altaica (Amur tiger): 102952667
Entry
102952667         CDS       T02988                                 

Gene name
UPP1
Definition
(RefSeq) uridine phosphorylase 1
  KO
K00757  uridine phosphorylase [EC:2.4.2.3]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102952667 (UPP1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102952667 (UPP1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     102952667 (UPP1)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 102952667
NCBI-ProteinID: XP_007073536
LinkDB
Position
Un
AA seq 313 aa
MASSGLQTKKRDNHNGHFVQPTNPNVATMQEDVLYHFHLSTSTHDLPAMFGDVKFVCVGG
SPTRMEAFTKYMAKELGLDHPGAEYPNICVGTDRYVMFKVGPVLSVSHGIGIPSTSVMLH
ELIKLLYHARCSDVTVIRIGTSGGIGLEPGSVVVTRQAVDASFKPVFEQMVLGKRVVHRT
HLDERLAQELMQCGADLREFPTVLGNTMCTSDFYEGQGRLDGALCSYSEKDKQEYLEAAH
AAGIRNIEMESSVLAAMCGACGLQVAGGCVTLLKRPGGXXXXXXGRVXQERPQRLGGHFI
KKRLAAAGNPRDL
NT seq 942 nt   +upstreamnt  +downstreamnt
atggcttcctcgggactccaaacaaagaaacgtgacaatcacaatggccactttgtacaa
cccaccaacccaaatgtagcaacaatgcaagaagatgtcctgtaccacttccatctcagc
accagcacgcacgatctccctgctatgtttggagatgtgaagttcgtgtgtgtcggggga
agccccacccggatggaagcgttcaccaaatacatggccaaggagctgggccttgaccac
ccaggtgcagaatatcccaacatctgtgtggggaccgaccgctacgtcatgttcaaagtg
ggccccgtgctgtctgtcagccacggcatcggcatcccttctacctcagtcatgctgcac
gagctcatcaagcttctgtaccacgcccgctgctccgacgtcactgtcatccgcatcggc
acctcgggtgggatcggtttggagcctggctctgtggtcgtcacccgccaggcggtggat
gcctccttcaagcccgtgttcgagcagatggtcctggggaagcgggtggttcataggaca
cacctggatgagcggctcgcgcaggagctgatgcagtgcggtgcagacctgcgggagttc
cccacggtcctggggaacaccatgtgcacctctgacttctatgaagggcaagggcgtctg
gacggtgccctctgctcctactcagagaaggacaagcaggagtacttggaggcggcccac
gcggccggcatccgcaacattgagatggagtcttcggtcctggctgccatgtgcggcgcg
tgcggcctccaagtggccgggggctgtgtcactctgctgaaacggccgggaggnnnnnnn
nnnnnnnnnnnnggtcgggtcnnccaggagcggccacagcgcctggggggtcacttcatc
aagaagcgcctcgcggctgccggaaacccccgggatctctga

DBGET integrated database retrieval system