KEGG   Panthera tigris altaica (Amur tiger): 102952674
Entry
102952674         CDS       T02988                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03320  PPAR signaling pathway
ptg04659  Th17 cell differentiation
ptg04919  Thyroid hormone signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05216  Thyroid cancer
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102952674 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102952674 (RXRB)
   03320 PPAR signaling pathway
    102952674 (RXRB)
   04919 Thyroid hormone signaling pathway
    102952674 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    102952674 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952674 (RXRB)
   05202 Transcriptional misregulation in cancer
    102952674 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    102952674 (RXRB)
   05216 Thyroid cancer
    102952674 (RXRB)
   05222 Small cell lung cancer
    102952674 (RXRB)
   05223 Non-small cell lung cancer
    102952674 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102952674 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ptg03310]
    102952674 (RXRB)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102952674 (RXRB)
Nuclear receptors [BR:ptg03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102952674 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 102952674
NCBI-ProteinID: XP_007093292
LinkDB
Position
Un
AA seq 463 aa
MPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQVRGRGSLTASPLSFPCFPCDPR
SLCELPHGPLTFQSSNPGRPVVLVRPLALPEINSTVSLPGGGSGPPEDVKPPVLGVRGLH
CPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVD
KRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELA
VEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVI
LLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRD
MRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgccaccccctccactgggctcccctttcccagtcatcagctcttccatggggtcccct
ggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccaggtgaga
ggtcgtggctcactgactgcctctccactttcatttccttgttttccttgtgaccccaga
tccttgtgtgaacttccccatggcccactgaccttccagtcctctaatcctggcaggcct
gtggtccttgtgagaccccttgcccttcctgagattaactcaacagtgtcgctccctggg
ggtgggtctggcccccctgaagatgtgaagccaccagtcttaggggtccggggcctgcac
tgtccaccccctccaggtggccctggggctggtaaacggctatgtgcaatctgcggggac
cgaagctcaggcaaacactacggggtttacagctgtgagggctgcaaaggcttcttcaag
cgtaccatccgtaaggacctgacctactcgtgccgggacaacaaggactgcacagtggac
aagcgccagcgaaaccgctgtcagtactgccgttatcagaagtgcctggccactggcatg
aagagggaggcggtacaggaggaacgtcagcgggggaaggacaaggacggggatggggag
ggggctgggggagcccccgaggagatgcctgtggacaggatcctggaggcagagcttgcc
gtggagcagaagagtgaccagggcgttgagggtcctgggggaaccgggggtagcggcagc
agcccaaatgaccccgtgactaacatctgtcaggcagctgacaaacagctattcacgctt
gttgagtgggcgaagaggatcccacacttttcttccttgcctctggatgaccaggtcata
ttgctacgggcaggctggaacgagctcctcattgcttccttctcccaccgatccattgat
gtccgagatggcatcctcctcgccacaggtcttcatgtgcaccgcaactcagcccattct
gcaggcgtgggagccatctttgatcgggtgctgacagagctagtgtccaaaatgcgtgac
atgaggatggacaagacagagcttggctgcctgagggcaatcattctgttcaatccagat
gccaagggtctctccaaccccagtgaggtggaggttctgagggagaaagtgtacgcatca
ctggagacctactgcaaacagaagtaccctgagcagcagggacggtttgccaagctgctg
ctacgtcttcctgccctcaggtccatcggccttaagtgtctagaacatctgtttttcttc
aagctcattggagacacccccattgacaccttcctcatggagatgcttgaggctccccac
cagctggcctga

KEGG   Panthera tigris altaica (Amur tiger): 102969338
Entry
102969338         CDS       T02988                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03320  PPAR signaling pathway
ptg04659  Th17 cell differentiation
ptg04919  Thyroid hormone signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05216  Thyroid cancer
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102969338 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102969338 (RXRG)
   03320 PPAR signaling pathway
    102969338 (RXRG)
   04919 Thyroid hormone signaling pathway
    102969338 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    102969338 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102969338 (RXRG)
   05202 Transcriptional misregulation in cancer
    102969338 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    102969338 (RXRG)
   05216 Thyroid cancer
    102969338 (RXRG)
   05222 Small cell lung cancer
    102969338 (RXRG)
   05223 Non-small cell lung cancer
    102969338 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102969338 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ptg03310]
    102969338 (RXRG)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102969338 (RXRG)
Nuclear receptors [BR:ptg03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102969338 (RXRG)
SSDB
Motif
Pfam: Nuc_recep-AF1 zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102969338
NCBI-ProteinID: XP_007078166
LinkDB
Position
Un
AA seq 415 aa
MYGNYSHFMKFPAGFGGSPGHSSSTSVSPLTALSTGKPMDSHPNYTDTPVSAPRTLSAVG
TPLNALGSPYRVIASAMGPPSGALAAPAGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MRMDKAELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtatgggaattattctcacttcatgaagtttcccgcaggcttcggaggctcccccggc
cactccagctccacgtctgtgagcccattgacagccttgtccacagggaagccaatggac
agccaccccaactacacggacacccccgtgagtgccccacggactctgagcgcggtgggg
acgcccctcaatgccctgggctctccatatagagtcatcgcctctgccatgggcccaccc
tcaggagcactggctgcgcctgcgggaatcaatctggttgccccgcccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggcttcctggg
atcggaaacatgaactacccatcaaccagccccggatccctggttaaacacatctgtgcc
atctgcggggacagatcctcaggaaagcactatggtgtgtatagctgtgaaggctgcaaa
ggcttcttcaagagaaccatacgcaaggacctcatgtacacgtgccgggataacaaggac
tgcctcattgacaagcgtcagcggaatcgctgtcagtactgccgctaccagaagtgcctg
gtgatgggcatgaagagagaagctgtgcaagaagaaaggcagaggagccgggagcgggcc
gagagtgaggccgaatgtgccagtagtggccatgaagatatgcctgtggagaggattcta
gaagctgagcttgctgttgaaccaaagacggaatcctatggtgacatgaatatggagaac
tcgacgaacgaccctgtcacgaacatatgccatgctgctgataagcagcttttcactctt
gtcgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatc
ctgctccgggcagggtggaacgaactgctaattgcctccttctcccaccgctccgtctcc
gtgcaggacggcattcttctggccaccggcttacatgtccaccgcagcagcgcccacagc
gctggggtcggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
atgcggatggacaaggcggagctggggtgcctgcgggccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctcggaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacacgaagcagaagtatccggaacaacctggcaggtga

DBGET integrated database retrieval system