KEGG   Panthera tigris altaica (Amur tiger): 102952697Help
Entry
102952697         CDS       T02988                                 

Gene name
MYBL2
Definition
(RefSeq) MYB proto-oncogene like 2
  KO
K21769  myb-related protein B
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102952697 (MYBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102952697 (MYBL2)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    102952697 (MYBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 SLIDE Spore_III_AB Atg29_N
Motif
Other DBs
NCBI-GeneID: 102952697
NCBI-ProteinID: XP_007077867
LinkDB All DBs
Position
Un
AA seq 728 aa AA seqDB search
MARLWKWFPPPPEEALVSLDGSIPDFVPELPNLEELDELHYQDTDSDVPEQRDSKCKVKW
THEEDEQLRTLVRQFGQQDWKFLASHFPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKV
IELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLG
NRWAEIAKMLPGRTDNAVKNHWNSTIKRKVDTGGFLSESKDCKPPVYLLLELEDKDGCQS
ARPVEDQGSLVTNWPPALPAMKEEESSEEEATAATTSKEQGAVPADLDGVRTPEPLEDFP
KREDQEGSLPETSLPYKWVVEAANLLIPAVGSSFSEALDLIESDPDAWCDLSKFDLPEEP
SAEGSISNSPVQPQPTQHQQQQALPPRQPAVPVPSVTEYRLDGHTISDLSRSSRGELIPI
SPSTEVGGLGVGTPPSVLKRQKKRRVALSPVTENSASLSFMDSCNSLTPKSTPVKTLPFS
PSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSM
DNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDEVRPEKQKRKT
GLRRSPIKKVRKSLALDIVDEDVKLVMSTLPKVLSLPTNVLSSSSSLSVPGIKEDNSLLN
EGFLQAKPEKPMAVQKSRSHFPTPAPMTSAWKTVACGGTRDQLFMQEKARQLLGRLKPSH
TSRTLILS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggccaggctgtggaagtggtttccaccgccgccagaggaggctttggtgtccctcgac
gggtccatccctgactttgtgccggaactccctaacctcgaggagctggatgagctgcac
taccaggatacagattcagacgtgccagagcagagggacagcaagtgcaaggtcaaatgg
acccacgaggaggatgagcagctgaggaccctggtaaggcagttcggacaacaagactgg
aagttcctggccagccactttcctaaccgcactgaccagcaatgccagtaccggtggctg
agggtcttgaatccagacctggtcaaggggccatggaccaaagaggaggaccaaaaggtc
atcgagctggtcaagaagtatggcacaaagcagtggacgctgatcgccaagcacctaaag
ggccggctggggaagcagtgccgtgagcgctggcacaaccacctcaaccctgaggtgaag
aagtcctgctggactgaggaggaggaccgcatcatctgtgaggcccacaaggtgctgggc
aaccgctgggccgagatcgctaagatgctgccggggaggacagacaatgctgtgaagaat
cactggaactccaccatcaaaaggaaggtggacacgggtggcttcctgagtgagtccaaa
gactgcaagccccctgtgtacttgctgctggagcttgaggacaaggacggctgccagagt
gcccgccccgtggaagaccagggaagtcttgtgaccaactggcccccagcgcttcctgcc
atgaaggaagaggaaagcagtgaggaggaagccacggcagccaccacttctaaggagcag
ggagctgtgcctgcggacctggatggagtgcgaacaccagagcccttggaggacttcccc
aagcgtgaagaccaggagggctccttgccagaaaccagcctgccctacaagtgggtggtg
gaggctgcaaacctcctcatccctgccgtggggtccagcttctcggaagccctggacttg
atcgagtcggaccctgatgcttggtgtgacctgagtaaatttgacctgcccgaggagccg
tctgcagagggcagcatcagcaacagtccagtgcagccacagccaacgcagcatcagcag
caacaggcactgccgccccgccagccagccgtcccggtgcccagtgtgaccgaatatcgt
ctggacggccacaccatctcagacctgagccggagcagccggggcgagctgatccccatt
tcccccagcactgaagtggggggcttgggcgtcggcacgccgccttcggtgctcaagcgg
cagaagaagcggcgcgtcgccctgtcccctgtaacggagaacagcgccagcctgtccttc
atggactcctgtaacagcctcacccccaagagcacacccgtcaagaccctgcccttctcg
ccctcccagtttctgaacttctggaacaaacaggacacactggagctggagagcccctca
ctgacgtccaccccggtgtgcagccagaaggtggtggtcaccactcccctgcaccgggat
aagacgcccctgcaccagaagcacgctgcgtttgtaaccccagatcagaagtactccatg
gacaacactcctcacacgccgaccccattcaagaatgccctggagaagtatggaccacta
aagcccctgccccagaccccgcacctggaggaggacttgaaggaggtgctgcgctctgag
gccggcatcgagctcattattgaggatgaagtgaggcctgagaagcagaagaggaagact
gggctgcggcggagccccatcaagaaggtccgcaagtccctggctcttgacattgtggat
gaggatgtgaagctggtgatgtccacactgcccaaggtgctgtccttgccgacaaatgtc
ctatcaagctcctccagcctctctgtgccaggcatcaaagaggacaacagcctacttaat
gagggcttcctgcaggctaagcccgagaagcccatggcggtgcagaagtcccgaagccac
tttccaacacctgcccctatgaccagcgcctggaagacggtggcctgcggggggaccagg
gaccagctcttcatgcaagaaaaagcccggcagctcctgggccgcttgaagcccagccac
acgtctcggaccctcatcttgtcctga

DBGET integrated database retrieval system