KEGG   Panthera tigris altaica (Amur tiger): 102952864
Entry
102952864         CDS       T02988                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05134  Legionellosis
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05222  Small cell lung cancer
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102952864
   04215 Apoptosis - multiple species
    102952864
   04115 p53 signaling pathway
    102952864
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952864
  09162 Cancer: specific types
   05210 Colorectal cancer
    102952864
   05222 Small cell lung cancer
    102952864
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102952864
   05012 Parkinson disease
    102952864
   05014 Amyotrophic lateral sclerosis
    102952864
   05016 Huntington disease
    102952864
   05017 Spinocerebellar ataxia
    102952864
   05020 Prion disease
    102952864
   05022 Pathways of neurodegeneration - multiple diseases
    102952864
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102952864
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102952864
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102952864
   05134 Legionellosis
    102952864
   05152 Tuberculosis
    102952864
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102952864
   05161 Hepatitis B
    102952864
   05160 Hepatitis C
    102952864
   05164 Influenza A
    102952864
   05162 Measles
    102952864
   05168 Herpes simplex virus 1 infection
    102952864
   05163 Human cytomegalovirus infection
    102952864
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952864
   05169 Epstein-Barr virus infection
    102952864
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102952864
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102952864
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 NCKAP5 Cytochrom_C550
Other DBs
NCBI-GeneID: 102952864
NCBI-ProteinID: XP_015397956
LinkDB
Position
Un
AA seq 107 aa
MGLQVFTGDVEKGKFFVQKCAQCHTVEKGSKPKTGPSLHGFFGQKAVQVPGFSYLDAMKN
KGIAWXEETLMEYXENPKKYIPGTKMIFTGIKKRGERADLTAYLRSC
NT seq 324 nt   +upstreamnt  +downstreamnt
atggggctgcaggtgttcacaggtgatgttgagaagggcaaattttttgttcagaagtgt
gcccaatgccatactgtggaaaagggaagcaagcccaagactgggccaagtctccatggt
ttctttggacaaaaggcagtccaggtccctggattttcttacctggatgccatgaagaac
aaaggcattgcttggngagaagagacactgatggaatatntggagaatcccaagaagtac
atccctggaacaaaaatgatcttcactggcattaagaagagaggagagagggcagatttg
acagcttatctcaggagctgctaa

KEGG   Panthera tigris altaica (Amur tiger): 102960081
Entry
102960081         CDS       T02988                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05134  Legionellosis
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05222  Small cell lung cancer
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102960081
   04215 Apoptosis - multiple species
    102960081
   04115 p53 signaling pathway
    102960081
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960081
  09162 Cancer: specific types
   05210 Colorectal cancer
    102960081
   05222 Small cell lung cancer
    102960081
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102960081
   05012 Parkinson disease
    102960081
   05014 Amyotrophic lateral sclerosis
    102960081
   05016 Huntington disease
    102960081
   05017 Spinocerebellar ataxia
    102960081
   05020 Prion disease
    102960081
   05022 Pathways of neurodegeneration - multiple diseases
    102960081
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102960081
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102960081
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102960081
   05134 Legionellosis
    102960081
   05152 Tuberculosis
    102960081
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102960081
   05161 Hepatitis B
    102960081
   05160 Hepatitis C
    102960081
   05164 Influenza A
    102960081
   05162 Measles
    102960081
   05168 Herpes simplex virus 1 infection
    102960081
   05163 Human cytomegalovirus infection
    102960081
   05167 Kaposi sarcoma-associated herpesvirus infection
    102960081
   05169 Epstein-Barr virus infection
    102960081
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960081
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102960081
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 102960081
NCBI-ProteinID: XP_007089101
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKARERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag
acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaaggcacgggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

KEGG   Panthera tigris altaica (Amur tiger): 102966744
Entry
102966744         CDS       T02988                                 

Definition
(RefSeq) cytochrome c 2-like
  KO
K08738  cytochrome c
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05134  Legionellosis
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05222  Small cell lung cancer
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102966744
   04215 Apoptosis - multiple species
    102966744
   04115 p53 signaling pathway
    102966744
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102966744
  09162 Cancer: specific types
   05210 Colorectal cancer
    102966744
   05222 Small cell lung cancer
    102966744
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102966744
   05012 Parkinson disease
    102966744
   05014 Amyotrophic lateral sclerosis
    102966744
   05016 Huntington disease
    102966744
   05017 Spinocerebellar ataxia
    102966744
   05020 Prion disease
    102966744
   05022 Pathways of neurodegeneration - multiple diseases
    102966744
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102966744
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102966744
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102966744
   05134 Legionellosis
    102966744
   05152 Tuberculosis
    102966744
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102966744
   05161 Hepatitis B
    102966744
   05160 Hepatitis C
    102966744
   05164 Influenza A
    102966744
   05162 Measles
    102966744
   05168 Herpes simplex virus 1 infection
    102966744
   05163 Human cytomegalovirus infection
    102966744
   05167 Kaposi sarcoma-associated herpesvirus infection
    102966744
   05169 Epstein-Barr virus infection
    102966744
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102966744
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102966744
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 102966744
NCBI-ProteinID: XP_007083977
LinkDB
Position
Un
AA seq 119 aa
MVDVFIAESKDRRGDAKAGEKIFIQKCAQCHTVEKGGKHKTGPNLWGLSGPGRKTGQAPG
FSFLMLTKTKGIIWGEETLIEYLENPKEYIPGTKMVFAGLKKKSEREDLIQYLKQATSS
NT seq 360 nt   +upstreamnt  +downstreamnt
atggtagatgtgtttatagctgaaagtaaagatagaaggggagatgctaaagcaggtgag
aagatctttattcagaaatgtgctcagtgccacacagtggaaaaaggtggaaaacacaag
actggtccaaatctctggggcctttctggccctggacgaaaaacaggacaagcaccagga
ttttcttttctgatgctaacaaaaacaaaaggtattatctggggagaggaaactctgata
gaatatttagagaacccaaaggaatatatccctggaactaaaatggtctttgctggtctt
aaaaagaagagtgagagagaagatcttattcagtatttgaaacaggcaacatcttcgtga

DBGET integrated database retrieval system