KEGG   Panthera tigris altaica (Amur tiger): 102953024
Entry
102953024         CDS       T02988                                 

Gene name
IL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04218  Cellular senescence
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05144  Malaria
ptg05146  Amoebiasis
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05219  Bladder cancer
ptg05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102953024 (IL8)
   04072 Phospholipase D signaling pathway
    102953024 (IL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102953024 (IL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102953024 (IL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102953024 (IL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102953024 (IL8)
   04621 NOD-like receptor signaling pathway
    102953024 (IL8)
   04622 RIG-I-like receptor signaling pathway
    102953024 (IL8)
   04657 IL-17 signaling pathway
    102953024 (IL8)
   04062 Chemokine signaling pathway
    102953024 (IL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953024 (IL8)
   05202 Transcriptional misregulation in cancer
    102953024 (IL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    102953024 (IL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102953024 (IL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102953024 (IL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102953024 (IL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102953024 (IL8)
   05135 Yersinia infection
    102953024 (IL8)
   05133 Pertussis
    102953024 (IL8)
   05134 Legionellosis
    102953024 (IL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102953024 (IL8)
   05171 Coronavirus disease - COVID-19
    102953024 (IL8)
   05164 Influenza A
    102953024 (IL8)
   05163 Human cytomegalovirus infection
    102953024 (IL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102953024 (IL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102953024 (IL8)
   05144 Malaria
    102953024 (IL8)
   05142 Chagas disease
    102953024 (IL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102953024 (IL8)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102953024 (IL8)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Chemokines
   102953024 (IL8)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Chemokines
   102953024 (IL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102953024
NCBI-ProteinID: XP_007087002
LinkDB
Position
Un
AA seq 101 aa
MTSKLVVAILAAFMLSAALCEAAVVSRISSELRCQCIKTHSTPFNPKLIKELTVIDSGPH
CENSEIIVKLVNGNEVCLDPKQKWVQKVVEIFLKKAEKQNA
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggttgttgctatcttagcagcttttatgctttctgcagctctgtgt
gaagctgcagttgtgtcaagaattagttcagaacttcgatgccagtgcataaaaactcat
tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac
tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaatgaggtgtgcctggacccc
aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat
gcataa

KEGG   Panthera tigris altaica (Amur tiger): 102953898
Entry
102953898         CDS       T02988                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04218  Cellular senescence
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05144  Malaria
ptg05146  Amoebiasis
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05219  Bladder cancer
ptg05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102953898
   04072 Phospholipase D signaling pathway
    102953898
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102953898
   04061 Viral protein interaction with cytokine and cytokine receptor
    102953898
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102953898
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102953898
   04621 NOD-like receptor signaling pathway
    102953898
   04622 RIG-I-like receptor signaling pathway
    102953898
   04657 IL-17 signaling pathway
    102953898
   04062 Chemokine signaling pathway
    102953898
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953898
   05202 Transcriptional misregulation in cancer
    102953898
  09162 Cancer: specific types
   05219 Bladder cancer
    102953898
  09163 Immune disease
   05323 Rheumatoid arthritis
    102953898
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102953898
   04933 AGE-RAGE signaling pathway in diabetic complications
    102953898
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102953898
   05135 Yersinia infection
    102953898
   05133 Pertussis
    102953898
   05134 Legionellosis
    102953898
  09172 Infectious disease: viral
   05161 Hepatitis B
    102953898
   05171 Coronavirus disease - COVID-19
    102953898
   05164 Influenza A
    102953898
   05163 Human cytomegalovirus infection
    102953898
   05167 Kaposi sarcoma-associated herpesvirus infection
    102953898
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102953898
   05144 Malaria
    102953898
   05142 Chagas disease
    102953898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102953898
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102953898
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Chemokines
   102953898
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Chemokines
   102953898
SSDB
Motif
Pfam: IL8 NucS
Other DBs
NCBI-GeneID: 102953898
NCBI-ProteinID: XP_007087005
LinkDB
Position
Un
AA seq 96 aa
MAAESSQRRFLLLAVFALSIFANLCEGQELRCQCIQTHSDPISPKFIKHVQLIPEGVHCS
RKEIIVTLEDGKLICLDPNAEWVMIIIKKIINSAPN
NT seq 291 nt   +upstreamnt  +downstreamnt
atggctgctgagagctcacaaagaagattcctcctgctggctgtctttgcactgagcatc
tttgccaatctctgtgaggggcaagagttgcgatgtcagtgtattcagacacattctgat
cctatttctccgaaattcattaaacatgtccagttgatacccgaaggtgttcactgcagc
aggaaagaaatcatagtcacattggaagatgggaaattaatttgtttggatcctaacgct
gaatgggtgatgattattatcaaaaagattatcaacagtgcccctaactga

DBGET integrated database retrieval system