KEGG   Panthera tigris altaica (Amur tiger): 102953099
Entry
102953099         CDS       T02988                                 

Gene name
ALDH3A1
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00340  Histidine metabolism
ptg00350  Tyrosine metabolism
ptg00360  Phenylalanine metabolism
ptg00410  beta-Alanine metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102953099 (ALDH3A1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102953099 (ALDH3A1)
   00350 Tyrosine metabolism
    102953099 (ALDH3A1)
   00360 Phenylalanine metabolism
    102953099 (ALDH3A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102953099 (ALDH3A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102953099 (ALDH3A1)
   00982 Drug metabolism - cytochrome P450
    102953099 (ALDH3A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102953099 (ALDH3A1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     102953099 (ALDH3A1)
SSDB
Motif
Pfam: Aldedh LuxC Sec8_exocyst
Other DBs
NCBI-GeneID: 102953099
NCBI-ProteinID: XP_007080822
LinkDB
Position
Un
AA seq 432 aa
MSKIGEVVQRARAAFNLGKTRPLQFRIQQLEALRRMIKEHEKDIAGALTADLHRVRQSPR
CYEEVVYVLEEIEHVIKKLPEWAADEPAEKTPQTQQDECYIHSEPLGVVLIIGTWNCPFT
VTVQPMVGAIAAGNAVVIKPSELSENMANLLATVIPQYLDRDLYPVINGGISETTEVLKE
RFDHILYTGNTAVGKIIMMAAAKHLTPVTLELGGKNPCYVDKDCDLDVACRRIAWGKFMN
SGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIVNSRHFQRVMGLME
GQKVAYGGTGDAATRYIAPTILTDVDPQSQVMQEEIFGPVMPIVCVRSLEEAIQFINQRE
KPLALYVFSLNDKVIKKMISETSSGGVTANDVVVHNSVHSLPYGGVGNSGMGSYHGKKSF
ETFSHRRSCLVR
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcaaaatcggcgaagtcgtgcagcgggccagggccgccttcaacttgggcaagacg
cgcccgctgcagttccggatccagcagctggaggcgctgcggcgcatgatcaaggagcac
gagaaggacatcgcgggcgcgctgacagcggacctccacagggtgcgccagagcccccga
tgctacgaggaggtggtgtatgtcctggaagagatcgaacacgtgatcaagaagctcccc
gagtgggctgcggacgagcccgcggagaagactccgcagacccagcaggatgagtgttac
atccactcggagcccctgggcgtggtcctcatcatcggcacctggaactgtcccttcact
gtcacggtccagcccatggtgggcgccatcgctgcagggaacgcggtggtcatcaagccc
tcggagctgagtgagaatatggcgaacctgctggccaccgtcatccctcagtacctggac
agggatctgtacccggtgatcaatgggggcatctctgagaccacagaggtcctcaaggag
agatttgaccacatcctatacaccgggaacaccgctgtgggcaagatcatcatgatggcc
gcagccaagcacctgacccccgtcaccctggagctagggggcaagaacccttgctacgtg
gacaaggactgtgatctggatgtcgcctgcagacgcatcgcctgggggaaattcatgaac
agtggccagacctgtgtggccccggactacatcctctgtgacccctccatccagaaccaa
attgtggagaagctcaaaaagtccctgaaagagttctacggggaggatgccaagaagtcc
cgtgactacggaaggatcgttaactcccggcacttccagagggtgatgggcctgatggag
ggtcagaaagtcgcctacggaggcactggggacgcggccacccgatacatcgcccccacc
atcctcacagacgtggacccccagtcccaggtgatgcaggaggagatctttgggcccgtg
atgcccattgtgtgtgtgcgcagcctggaggaggccatccagttcatcaaccaacgggag
aagcccctggccctctatgtgttctctctaaatgacaaggtgattaagaagatgatttcg
gagacctcgagcggtggcgtgacggccaacgacgtcgttgtccacaactctgtgcactcc
ctgccttacgggggtgtggggaacagcggcatggggtcctaccacggcaagaagagcttt
gagaccttttcccaccgccgctcctgcctggtgcgctga

KEGG   Panthera tigris altaica (Amur tiger): 102964294
Entry
102964294         CDS       T02988                                 

Gene name
ALDH3B2
Definition
(RefSeq) aldehyde dehydrogenase 3 family member B2
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00340  Histidine metabolism
ptg00350  Tyrosine metabolism
ptg00360  Phenylalanine metabolism
ptg00410  beta-Alanine metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102964294 (ALDH3B2)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102964294 (ALDH3B2)
   00350 Tyrosine metabolism
    102964294 (ALDH3B2)
   00360 Phenylalanine metabolism
    102964294 (ALDH3B2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102964294 (ALDH3B2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102964294 (ALDH3B2)
   00982 Drug metabolism - cytochrome P450
    102964294 (ALDH3B2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102964294 (ALDH3B2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     102964294 (ALDH3B2)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 102964294
NCBI-ProteinID: XP_015398411
LinkDB
Position
Un
AA seq 424 aa
MVPMAAFEADISELIMCQNEVDLALKNLPTWMKDEPVAKNLLTQMGSAFIRKEPFGLALI
ISPWNYPVNLTLVPLVGALAAGNCVVLKPSEISKSTEKVLAEVLPQYLDQSCFAVVLGGP
QETGRLLEHKFDYIFFTGSPRVGRIVMSAAAKHLTPVTLELGGKNPCYVDDDCDPQTVAN
RVTWFRYFNTGQTCVAPDYVLCSPDTQERLLPALQSAITRFYGEDPRSSPNLGRIISDKH
FQRLPGPPGGXXXXXXXXARGAMGGQGDESGRSMAPTVLVDVEETEPVMQEEIFGPILPI
VNVRSLDEAIDFINRREKPLALYAFSNNKQVVNQILDRTSSGSFGGNEGFTYLTLTSLPL
GGVGNSGMGRYHGKFSFDTFSHHRACLLSHPGLEKLNEIRYPPYTNSKEQLVSWALGSQS
CTLL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggtccccatggcagctttcgaggcagacatatccgagctcatcatgtgccagaacgag
gtcgacctcgcgctcaagaacctgcccacctggatgaaggacgagcctgtggccaagaac
ctgctcacgcagatgggctctgccttcatccggaaggagcccttcggcctggcgctcatc
atcagcccctggaactatcccgtgaacctgaccctggtgcccctggtgggtgccctcgcc
gcagggaactgtgtggtgctgaagccgtcagaaataagcaagagcacagagaaggtcctg
gctgaggtcctgccccagtacctggaccagagctgcttcgccgtggtgctgggcggtccc
caggagacagggcggctgctggagcacaagttcgactacatcttcttcacggggagccct
cgggtgggcaggatcgtcatgtctgccgccgccaagcacctgacgcccgtcacgctggag
ctggggggcaagaacccctgctacgtggacgacgactgtgacccccagaccgtggccaac
cgcgtgacctggttccgctacttcaacaccggccagacctgcgtggcccccgactacgtc
ctgtgcagccctgacacgcaggagcggctgctgcccgccctgcagagcgccatcacccgc
ttctacggcgaggacccccggagctccccgaacctgggccgcatcatcagcgacaagcac
ttccagcggctcccaggcccgccgggcggnnnnnnnnnnnnnnnnnnnnnnnnngcccgc
ggggccatgggcggccagggcgacgagagcgggcgctccatggcccccacggtgctggtg
gacgtggaggagacggaacccgtgatgcaggaggagatcttcggacccatcctgcccatc
gtgaacgtgaggagcctggacgaggccatcgacttcatcaaccgtcgggagaagcccttg
gccctgtacgccttctccaacaacaaacaggtagtgaaccagatactggatcggaccagc
agcgggagtttcggaggcaatgagggcttcacctacctgactctgacgtccctgccgctg
gggggagtcgggaacagcgggatgggacgatatcacggcaagttctccttcgacaccttc
tcccaccaccgcgcctgtctgctctcccaccccggcctggagaagctcaatgaaatccgc
taccctccctacactaacagcaaagagcagctggtcagctgggccttggggtcccaaagc
tgcacccttctgtga

KEGG   Panthera tigris altaica (Amur tiger): 102969525
Entry
102969525         CDS       T02988                                 

Gene name
ALDH3B1
Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00340  Histidine metabolism
ptg00350  Tyrosine metabolism
ptg00360  Phenylalanine metabolism
ptg00410  beta-Alanine metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102969525 (ALDH3B1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102969525 (ALDH3B1)
   00350 Tyrosine metabolism
    102969525 (ALDH3B1)
   00360 Phenylalanine metabolism
    102969525 (ALDH3B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102969525 (ALDH3B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102969525 (ALDH3B1)
   00982 Drug metabolism - cytochrome P450
    102969525 (ALDH3B1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102969525 (ALDH3B1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     102969525 (ALDH3B1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 102969525
NCBI-ProteinID: XP_015398410
LinkDB
Position
Un
AA seq 425 aa
MNERANRRACLEEAVPATGLWPPANAGPLASPPQSAFESEVSEISITQSEINLALRNLRA
WMKDEKVPKNLATQLDSAFIRKEPFGLVLVIAPWNYPVNLTLVPLVGALAAGNCVVLKPS
EPGKGGRPHAGPARQGGAAPGGRPSLWVLRAGVPEGSLCHPVLQSCFAVVLGGPQEMGQL
LEHKFDYIFFTGSPRVGRIVMSAAAKHLTPVTLELGGKNPCYVDDDCDPQTVANRLAWFR
YFNTGQTCVAPDYRVGWVRGAIGGQSDESERYIAPTVLVDVEETEPVMQEEIFGPILPIV
NVRSLDEAIDFINRREKPLALYAFSNSKQVVKRVLAQTSSGSFCGNDGFMHLTLASLPFG
GVGASGMGSYHGKFSFDTFSHHRACLLRCPGMEKIYSIRYPPYSPRKLRVLLMAMEARGC
SCTLL
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaacgaacgagcaaataggagggcttgcttggaggaggctgtgcccgccacagggctc
tggccacctgccaacgctggtcccctggcctctcccccgcagtcagccttcgagtcggaa
gtgtctgagatcagcatcacccagagtgagatcaacttggccctcaggaatctgagggcc
tggatgaaggatgagaaagtgcccaagaatctggccacgcagctggactcggccttcatc
cggaaggagcccttcggcctggtgcttgtcatcgccccctggaactaccctgtgaacctg
accctcgtgcccctggtgggcgcccttgccgcagggaactgcgtggtgctgaagccatcg
gagccaggcaaaggggggcggccccacgcaggtccggccaggcaagggggggcggcccca
ggcgggcggcccagcctctgggttctccgggctggggtcccagagggatccctctgccat
cccgtcctacagagctgctttgccgtggtgctgggcgggccccaggagatggggcagttg
ctggagcacaagttcgactacatcttcttcacggggagccctcgggtgggcaggatcgtc
atgtctgccgccgccaagcacctgacgcccgtcacgctggagctggggggcaagaacccc
tgctacgtggacgacgactgtgacccccagaccgtggccaaccgcctggcctggttccgc
tacttcaacaccggccagacctgcgtggcccccgactaccgggtgggctgggtccgcggg
gccattggcggccagagcgacgagagcgagcgctacatcgcccccacggtgctggtggac
gtggaggagacggaacccgtgatgcaggaggagatcttcggacccatcctgcccatcgtg
aacgtgaggagcctggacgaggccatcgacttcatcaaccgtcgggagaagcccctggcc
ctgtacgccttctccaacagcaaacaggtggtcaagcgagtgctggcccagaccagcagt
gggagcttctgcgggaacgacggcttcatgcacttgaccctcgccagcctgccttttgga
ggagtgggtgccagcgggatgggcagctaccacggcaagttctcctttgacaccttctcc
caccaccgcgcctgcctgctgcgctgccccgggatggagaagatctactccatccgctac
ccgccctactcacctcgcaagctgagggtgctgctgatggccatggaggcccgtggctgc
agctgcaccttgctctga

DBGET integrated database retrieval system