KEGG   Panthera tigris altaica (Amur tiger): 102953134
Entry
102953134         CDS       T02988                                 

Gene name
CES2
Definition
(RefSeq) carboxylesterase 2
  KO
K03927  carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102953134 (CES2)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102953134 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     102953134 (CES2)
    3.1.1.84  cocaine esterase
     102953134 (CES2)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 PNPase_C
Other DBs
NCBI-GeneID: 102953134
NCBI-ProteinID: XP_007090312
LinkDB
Position
Un
AA seq 556 aa
MRLDLLRGCLSAVVCGLLLLVLGQGQDSASPIRTTHTGQVRGSLIHVKGTDVGVHTFLGI
PFAKPPLGPLRFAPPEPPESWSGVKDGTSHPAMCLQNITTTNELFLKLLNATLPFTSMSE
DCLYLSIYTPAHAREGSNLPVLVWIHGGGFTVGMASMYDGSALAAFEDLVVVIIQYRLGV
LGFFSTGDKHATGNWGYLDQVAALRWVQQNIAYFGGDPGRVTISGESAGGTSVSSHVVSP
MSKGLFHGAIMESGVALLPSLIDSSSDAVSTMVANMSACGQIDSEALVDCLRGKSEEEIL
AINKPFRIIPGMVDGTFLPRHPHELLASADFQPVPSIIGVNNDEYGWLIPSALDISDTQK
DRETVKAVLRNMLAMLVLPPQSVDLLMEEYLGDSADPQTLQVQFHEMMGDYIFVIPALQV
ASFQRVHAPVYFYEFQHRPSFFKDTKPPHVRADHGDEMFFVFGTAFWKDYVEVTEEEELL
SRKMMKYWANFARNGNPNGKGLPHWPVFDQEEQYLQLNLQPAVGRALKAHRLQFWTKILP
QKIQELKEAEENHTEL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgcgactggacctacttcgcgggtgtctgagcgccgtggtctgtgggctcctgcttctc
gtcctgggccagggccaggactctgccagccccatccggaccacacacacggggcaggtg
cgggggagcctcatccacgtgaaaggcactgatgtgggggtccacaccttcctgggaatt
ccctttgctaaaccgcctctaggaccactgcgatttgcaccccctgagccccctgaatct
tggagtggtgtaaaggacgggacctcccacccagctatgtgtctgcagaacatcactacc
acaaatgagttgtttctgaaactgctgaatgcgaccttgcctttcacctccatgtccgaa
gactgcctgtacctcagcatttacacaccggcccacgccagggaaggctccaatctgccc
gtgttggtgtggatccatggtggtgggtttacggtcggcatggcttccatgtatgatggc
tctgcactggcggcctttgaggacctggtggtggtcattattcagtaccgcctgggtgta
ctgggcttcttcagcactggagacaagcatgcaaccggcaactggggctacctggatcaa
gtggctgcactacgctgggtccagcaaaatattgcctattttggaggagaccctggccgt
gtcaccatttctggcgagtctgcaggtggcacaagtgtgtcctcacatgtcgtgtccccc
atgtccaaaggactcttccatggtgccatcatggagagtggtgtggctctattgcccagc
ctcattgatagctcatctgatgcggtctccacgatggtggcaaacatgtctgcctgtggc
cagattgactcagaggcactggtggactgcctgaggggcaagagtgaagaggagattctg
gccattaataagcccttcaggatcatccctggcatggtggatgggaccttcctgcccagg
cacccccacgagctgctggcctctgccgactttcaacctgtccccagcatcattggtgtc
aacaacgatgagtacggttggctcatcccctcggccttggacatctctgacactcagaag
gacagagagactgtgaaggctgttctgcggaatatgttggcaatgttggtgttgcctcct
cagtctgttgacctattgatggaggagtacttaggggacagtgcggacccacagaccctc
caggtccagttccatgagatgatgggggactatatcttcgtgatccctgcactccaagta
gccagttttcaacgtgtgcatgcccccgtctacttctatgagttccagcatcggcccagc
ttcttcaaggacaccaagccaccccacgtgagggcagaccatggtgatgagatgttcttt
gtcttcggaactgccttctggaaagactatgttgaagtcactgaggaggaagagctgttg
agcaggaagatgatgaagtactgggctaacttcgctcgaaacgggaaccccaacggcaag
ggtctgccccactggcctgtgttcgaccaggaagagcaatacttgcagctgaacttgcag
cctgcggtgggccgagccctgaaggcccacaggctccagttttggacaaagatcctaccc
cagaagatacaggagctaaaggaggcggaggaaaatcacacagagctgtaa

KEGG   Panthera tigris altaica (Amur tiger): 102957516
Entry
102957516         CDS       T02988                                 

Gene name
CES1
Definition
(RefSeq) carboxylesterase 1
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102957516 (CES1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102957516 (CES1)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 Esterase
Other DBs
NCBI-GeneID: 102957516
NCBI-ProteinID: XP_007090239
LinkDB
Position
Un
AA seq 567 aa
MMWLLALVLTSLTTSMTWAGHPSSPPVVDTSQGKVLGKHVSVEGFAQPVAVFLGIPFARP
PLGSLRFAPPQPAEPWNFVKNTTSDPPMCSQDAVGGQVLSDLFTNRKENIPLKFSEDCLY
LNIYTPADLRKKNRLPVMVWIHGGGLMVGGASTYSGLVLSAHENVVVVTIQYRLGIWGYF
STGDEHSRGNWGQLDQVAALRWVQENIANFGGNPGSVTIFGESAGGISVSILVLSPLAKN
LFHRAISESGVALTTALVKKDLKDAAQQIAFFAGCKTTTSAVTVRCLRQKTEEELLEISR
KMKFFSIDLYGDPRESHPFLPIVVDGVLLPKMPEEILAEKKFNFVPYIIGINKHEFGWLL
PKLMGYPLSEGKLDQKTAMSLLWKSYPLIGIPEELIPLAAEKYLEGTDDPVKKKDLFLDT
IGDVIFGVPSVTVARYHRDAGAPTYMYEFQYHPSFSSDMKPKTLIGDHGDELFSVFGAPF
LKGGASEEEIRLSKMMMKFWANFARSGNPNGEGLPSWPAYDQKEGYLQIGATTQPAQKLK
DKEVAFWTELLAKGAAKKPPHKEHVEL
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgatgtggctcttagctctggtcttgacctccctcaccacttccatgacttgggcaggg
cacccgtcctcacctcctgtggtggacacctctcaaggcaaagtcctgggcaagcacgtc
agcgtagaaggatttgcacagcctgtggccgtcttcctgggaatcccttttgccaggcct
cctcttggatccctgaggtttgctccaccacagcctgcagagccatggaacttcgtgaag
aataccacctccgaccctcctatgtgttcccaggatgcagtgggagggcaggtgctctcc
gacctctttaccaacaggaaggaaaacattcctctcaagttttccgaagactgcctgtac
ctaaatatttacactcctgctgacttgaggaagaagaacaggctgcccgtgatggtgtgg
atccacggagggggtctgatggtgggcggagcatcaacctatagtggactggtcctctct
gcccatgaaaatgtggtggtggtgaccattcagtaccgcctgggcatctggggatacttc
agcacaggggacgaacacagccggggaaactggggtcagttggaccaggtggccgcactt
cgctgggtccaggagaacattgccaactttggagggaacccgggttctgtcactatcttt
ggagagtcagcaggaggtatcagcgtctctattctcgtgttatctccactggccaagaac
ctcttccaccgggccatctccgagagtggcgtggccctcactactgccctggtcaagaaa
gacctgaaggatgcagctcagcaaattgctttctttgctgggtgtaaaaccaccacctcg
gctgtcactgttcgctgcctgcgccagaagacagaagaggagctcttggagatatcgcgg
aagatgaaatttttcagtattgatttatatggagaccccagagagagccatcccttcctg
cccatcgtggtggacggagtactgttaccaaagatgcctgaagagattctggcagaaaag
aaattcaactttgttccctatatcatcggaatcaacaagcatgagtttggttggcttctt
ccaaagctgatgggttacccactctctgaaggcaagctggaccagaagacagccatgtca
ctcctgtggaagtcttacccgcttattggcatccctgaggaattgattccactggccgct
gagaagtatttagaagggacagatgaccctgtcaaaaagaaagacctgttcttggacaca
attggagatgtgatatttggtgtcccatctgtgactgtggcccgttaccacagagatgcc
ggagcccccacgtacatgtatgagttccagtatcatccaagcttctcatcagacatgaaa
cccaagacgttgataggggaccacggcgatgagctgttctcagtcttcggggcaccattt
ttaaaaggaggtgcttcagaagaggagatcagactcagcaagatgatgatgaaattttgg
gccaattttgctcggagtgggaaccccaatggggaaggactgccctcttggccggcatat
gaccagaaggaagggtatctgcagattggagccaccactcagccagcccagaagctgaaa
gacaaggaagtggctttctggaccgagctcctggccaagggggcagcaaaaaagccaccc
cacaaagagcacgttgagctgtga

DBGET integrated database retrieval system