KEGG   Panthera tigris altaica (Amur tiger): 102953174
Entry
102953174         CDS       T02988                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04062  Chemokine signaling pathway
ptg04217  Necroptosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05212  Pancreatic cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102953174 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102953174 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102953174 (STAT1)
   04621 NOD-like receptor signaling pathway
    102953174 (STAT1)
   04625 C-type lectin receptor signaling pathway
    102953174 (STAT1)
   04658 Th1 and Th2 cell differentiation
    102953174 (STAT1)
   04659 Th17 cell differentiation
    102953174 (STAT1)
   04062 Chemokine signaling pathway
    102953174 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102953174 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    102953174 (STAT1)
   04919 Thyroid hormone signaling pathway
    102953174 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102953174 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953174 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102953174 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102953174 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102953174 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102953174 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102953174 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102953174 (STAT1)
   05160 Hepatitis C
    102953174 (STAT1)
   05171 Coronavirus disease - COVID-19
    102953174 (STAT1)
   05164 Influenza A
    102953174 (STAT1)
   05162 Measles
    102953174 (STAT1)
   05168 Herpes simplex virus 1 infection
    102953174 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102953174 (STAT1)
   05169 Epstein-Barr virus infection
    102953174 (STAT1)
   05165 Human papillomavirus infection
    102953174 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102953174 (STAT1)
   05140 Leishmaniasis
    102953174 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102953174 (STAT1)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102953174 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 DUF1633 BLI1
Other DBs
NCBI-GeneID: 102953174
NCBI-ProteinID: XP_007094755
LinkDB
Position
Un
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQMLIKKMYLMLDSKRKEVVHKIIELLNITELTQKALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFNLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPIVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGPVEFDTMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgagcttcaacagcttgactccaaattcctggaacaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtacctagcacagtggctagaaaag
caagactgggagcatgctgctaatgatgtttcatttgccaccatccgttttcatgacctc
ctatcacagctggatgatcaatacagtcgcttttctttggaaaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgattatctataactgtctgaaggaagaaaggaagatcctggaaaatgcccag
agattcaatcaggcgcagtcggggaatattcagagcactgtgatgttagacaaacagaag
gagcttgacagtaaagtcagaaatgtgaaggataaagttatgtgtatagagcatgaaatc
aagacactagaagacttacaagatgaatatgactttaaatgcaagaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaaaaatgatcagaaacaagaacagatgttaatcaag
aagatgtatttaatgcttgacagtaagagaaaggaagtagttcacaaaataatagagttg
ttgaacatcactgaacttacccagaaagccctgattaatgatgaactggtggagtggaag
cagagacagcagagtgcctgtattgggggaccccccaacgcttgtcttgatcagctgcaa
aactggttcaccatagttgccgagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggaattggaacagaaatacacctatgaacacgaccctatcacaaaaaacaaacaaggg
ctgtgggaccgcaccttcaacctgttccaacagctcattcagagctcatttgtggtggaa
agacagccttgcatgccaactcatcctcagaggccactagtcttgaagactggggtccag
ttcaccgtgaagttgagactgttggtgaaattgcaggagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaacgagagaaatacagtaaaaggatttagaaaattc
aacattttgggcacacatacaaaagtgatgaacatggaggaatccaccaacggaagtctg
gccgccgaatttcgacacctgcaactgaaagaacagaaaaatgctggcaccagaactaat
gagggccccctcatcgttacagaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgacctcgagacgacctctctgcccatcgtggtgatctccaat
gtcagccagctcccgagtggctgggcctccatcctgtggtacaacatgctggtgacagaa
cccaggaatctgtccttcttcctgaacccgccctgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggagagaagctacttggtcctaatgctggccccgatggtctcattccgtggacg
aggttctgtaaggaaaatataaatgacaaaaattttcctttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctctctctgtggaatgatgggtgtatcgtgggc
tttatcagcaaggagcgagagcgtgccctgctgaaggatcagcagccagggacgttcctg
ctgcggttcagtgagagctgccgggaaggggccatcacgttcacgtgggtggagcggtcc
cagaacggaggggaaccttacttccacgcagtggaaccctacacgaagaaagaactttct
gctgttactttccctgatattattcgcaattacaaagtcatggctgctgaaaatattcca
gagaatcccctgaagtatctgtatccaaatattgataaggaccatgcctttggaaaatac
tactccaggccaaaggaagctccagaaccaatggaacttgatggccctaaaggaactgga
tacatcaagactgaattgatttctgtgtctgaagttcatccttctcgacttcagaccaca
gacaatcttctccccatgtctcctgaggagtttgacgaggtgtctcggatagtgggtcct
gtagaattcgacactatgatgaatgcagtatag

DBGET integrated database retrieval system