KEGG   Panthera tigris altaica (Amur tiger): 102953222
Entry
102953222         CDS       T02988                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04068  FoxO signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04217  Necroptosis
ptg04650  Natural killer cell mediated cytotoxicity
ptg04722  Neurotrophin signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04940  Type I diabetes mellitus
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05320  Autoimmune thyroid disease
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102953222 (FASLG)
   04014 Ras signaling pathway
    102953222 (FASLG)
   04068 FoxO signaling pathway
    102953222 (FASLG)
   04151 PI3K-Akt signaling pathway
    102953222 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102953222 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102953222 (FASLG)
   04217 Necroptosis
    102953222 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102953222 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102953222 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953222 (FASLG)
   05205 Proteoglycans in cancer
    102953222 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102953222 (FASLG)
   05330 Allograft rejection
    102953222 (FASLG)
   05332 Graft-versus-host disease
    102953222 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102953222 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102953222 (FASLG)
   04932 Non-alcoholic fatty liver disease
    102953222 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102953222 (FASLG)
   05161 Hepatitis B
    102953222 (FASLG)
   05160 Hepatitis C
    102953222 (FASLG)
   05164 Influenza A
    102953222 (FASLG)
   05162 Measles
    102953222 (FASLG)
   05168 Herpes simplex virus 1 infection
    102953222 (FASLG)
   05163 Human cytomegalovirus infection
    102953222 (FASLG)
   05165 Human papillomavirus infection
    102953222 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102953222 (FASLG)
   05143 African trypanosomiasis
    102953222 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102953222 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102953222 (FASLG)
   04052 Cytokines and growth factors [BR:ptg04052]
    102953222 (FASLG)
   04090 CD molecules [BR:ptg04090]
    102953222 (FASLG)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102953222 (FASLG)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Tumor necrosis fators
   102953222 (FASLG)
CD molecules [BR:ptg04090]
 Proteins
  102953222 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 102953222
NCBI-ProteinID: XP_007084079
LinkDB
Position
Un
AA seq 282 aa
MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPP
PPPLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTS
QKHVASSLEKQIGQLNPPSEKKELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKG
GLVINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKIMNYCTTGQMW
ARSSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 849 nt   +upstreamnt  +downstreamnt
atgcagcagcccctgaattacccatacccccaaatctactgggtggacagcagggccagc
tctccctggggccctcctgggtcggtcctcccgtgtccatcctctgtgccaggaaggcct
ggacaaaggaggccgccaccgccaccaccaccaacactaccaccaccgccaccaccaccg
ccaccaccgctgcccccactgccattgccacctctgaagacgaggagggaccacaacaca
gggctgtgtcttcttgtgatgtttttcatggttctggtggccctggttggactggggctg
gggatgtttcagctcttccacctccagaaggagctggctgaactcagagagtccaccagc
caaaagcacgtagcatcatctttggagaaacaaataggtcaactcaatccaccctctgaa
aaaaaggagctgagaaaagtggcccatttaacaggcaagcccaactcaagatccatccct
ctggaatgggaagacacatatggaattgcccttgtctctggggtgaagtataagaagggt
ggccttgtgatcaatgacactgggatgtactttgtatattccaaagtgaacttcaggggt
cagtcctgcaacaaccaacccctgaaccacaaggtctatatgaggaactctaagtatccc
caggacctggtgctgatggaagggaagatcatgaactactgcactactggccagatgtgg
gcccgcagcagctacctgggggcagtattcaatctcaccagtgctgaccatttatatgtc
aatgtatctgaattatctctggtcagttttgaggaatctaagacattttttggcttatat
aagctctaa

DBGET integrated database retrieval system