Panthera tigris altaica (Amur tiger): 102953222 Help Entry 102953222         CDS       T02988                                  Gene name FASLG Definition (RefSeq) Fas ligand   KO K04389   tumor necrosis factor ligand superfamily member 6 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01524   Platinum drug resistance ptg04010   MAPK signaling pathway ptg04014   Ras signaling pathway ptg04060   Cytokine-cytokine receptor interaction ptg04068   FoxO signaling pathway ptg04151   PI3K-Akt signaling pathway ptg04210   Apoptosis ptg04217   Necroptosis ptg04650   Natural killer cell mediated cytotoxicity ptg04722   Neurotrophin signaling pathway ptg04932   Non-alcoholic fatty liver disease ptg04940   Type I diabetes mellitus ptg05022   Pathways of neurodegeneration - multiple diseases ptg05142   Chagas disease ptg05143   African trypanosomiasis ptg05160   Hepatitis C ptg05161   Hepatitis B ptg05162   Measles ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05165   Human papillomavirus infection ptg05168   Herpes simplex virus 1 infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05205   Proteoglycans in cancer ptg05320   Autoimmune thyroid disease ptg05330   Allograft rejection ptg05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102953222 (FASLG)    04014 Ras signaling pathway     102953222 (FASLG)    04068 FoxO signaling pathway     102953222 (FASLG)    04151 PI3K-Akt signaling pathway     102953222 (FASLG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102953222 (FASLG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102953222 (FASLG)    04217 Necroptosis     102953222 (FASLG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102953222 (FASLG)   09156 Nervous system    04722 Neurotrophin signaling pathway     102953222 (FASLG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102953222 (FASLG)    05205 Proteoglycans in cancer     102953222 (FASLG)   09163 Immune disease    05320 Autoimmune thyroid disease     102953222 (FASLG)    05330 Allograft rejection     102953222 (FASLG)    05332 Graft-versus-host disease     102953222 (FASLG)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     102953222 (FASLG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102953222 (FASLG)    04932 Non-alcoholic fatty liver disease     102953222 (FASLG)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102953222 (FASLG)    05161 Hepatitis B     102953222 (FASLG)    05160 Hepatitis C     102953222 (FASLG)    05164 Influenza A     102953222 (FASLG)    05162 Measles     102953222 (FASLG)    05168 Herpes simplex virus 1 infection     102953222 (FASLG)    05163 Human cytomegalovirus infection     102953222 (FASLG)    05165 Human papillomavirus infection     102953222 (FASLG)   09174 Infectious disease: parasitic    05142 Chagas disease     102953222 (FASLG)    05143 African trypanosomiasis     102953222 (FASLG)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102953222 (FASLG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102953222 (FASLG)    04052 Cytokines and growth factors [BR:ptg04052]     102953222 (FASLG)    04090 CD molecules [BR:ptg04090]     102953222 (FASLG) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102953222 (FASLG) Cytokines and growth factors [BR:ptg04052]  Cytokines   Tumor necrosis fators    102953222 (FASLG) CD molecules [BR:ptg04090]  Proteins   102953222 (FASLG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF GutM Motif Other DBs NCBI-GeneID:  102953222 NCBI-ProteinID:  XP_007084079 LinkDB All DBs Position Un AA seq 282 aa AA seqDB search MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPP PPPLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTS QKHVASSLEKQIGQLNPPSEKKELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKG GLVINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKIMNYCTTGQMW ARSSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL NT seq 849 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcccctgaattacccatacccccaaatctactgggtggacagcagggccagc tctccctggggccctcctgggtcggtcctcccgtgtccatcctctgtgccaggaaggcct ggacaaaggaggccgccaccgccaccaccaccaacactaccaccaccgccaccaccaccg ccaccaccgctgcccccactgccattgccacctctgaagacgaggagggaccacaacaca gggctgtgtcttcttgtgatgtttttcatggttctggtggccctggttggactggggctg gggatgtttcagctcttccacctccagaaggagctggctgaactcagagagtccaccagc caaaagcacgtagcatcatctttggagaaacaaataggtcaactcaatccaccctctgaa aaaaaggagctgagaaaagtggcccatttaacaggcaagcccaactcaagatccatccct ctggaatgggaagacacatatggaattgcccttgtctctggggtgaagtataagaagggt ggccttgtgatcaatgacactgggatgtactttgtatattccaaagtgaacttcaggggt cagtcctgcaacaaccaacccctgaaccacaaggtctatatgaggaactctaagtatccc caggacctggtgctgatggaagggaagatcatgaactactgcactactggccagatgtgg gcccgcagcagctacctgggggcagtattcaatctcaccagtgctgaccatttatatgtc aatgtatctgaattatctctggtcagttttgaggaatctaagacattttttggcttatat aagctctaa

DBGET integrated database retrieval system