KEGG   Panthera tigris altaica (Amur tiger): 102953321
Entry
102953321         CDS       T02988                                 

Gene name
UCKL1
Definition
(RefSeq) uridine-cytidine kinase 1 like 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102953321 (UCKL1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102953321 (UCKL1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     102953321 (UCKL1)
SSDB
Motif
Pfam: PRK UPRTase CPT AAA_18 AAA_33 Zeta_toxin CoaE
Other DBs
NCBI-GeneID: 102953321
NCBI-ProteinID: XP_015395173
LinkDB
Position
Un
AA seq 482 aa
MPVASASEAGSECRSFHAGGSSDPTPAPHPQHFLPTHGGTVQASPELSEGATVGLNGPVE
MLLQTPGITLLSTVPCVPAMSSPPAYPGIRISGCWALGAEGRXVAGLLSPAAVVRRSPRK
RTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMII
EALDVPWVVLLSMDSFSKVLTTQQQEQAARNDFNFDHPDAFDFDLIVSTLKKLKQGKSVK
VPVYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLR
RDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRVADIVVPWGSGNTVAIDLIVQHMHSQ
LEERKLRWDMAALASAHQCHPLPQTLSVLESTPQVRGMHTIIRDKETSRDEFIFYSKRLM
RLLIEHALSFLPFQVRGGPRHEGLLPSPGNFGDRYFGTDAVPDGSDEEEWPPRASLSEPE
RA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgcccgtggcctcagcctctgaggccggcagtgagtgccgttccttccacgcgggaggc
tcttcggacccaaccccagctcctcacccgcagcacttcctgcccacacatggagggaca
gttcaggcgtctcctgagctgtccgagggggccactgtgggtctaaatggccctgtggag
atgctcctgcagacacctgggatcaccctgctgtccactgtcccctgtgtcccagccatg
agcagccccccagcttaccctggcatcaggatctcgggatgctgggccctcggagcagaa
ggcaggtgagtggcaggcctgttgtcccccgcggctgtagtgaggcgctcgccccggaag
cgcaccaccagccagtgcaagtctgagccgcccctgctgcgcaccagcaagcgcaccatc
tacacagccgggcggccgccctggtacaacgagcatggcacgcagtccaaggaggccttc
gccatcggcctgggaggtggcagcgcctccgggaagacaactgtggccaggatgatcatc
gaggccctggacgtgccctgggtggtcttgctgtccatggactccttctccaaggtgctc
accacgcagcagcaggagcaggctgcccgcaacgacttcaactttgaccatccagacgcc
tttgactttgacctcattgtgtccaccctcaagaagctgaagcagggcaagagtgtcaag
gttcccgtgtacgacttcaccacccacagccggaagaaagactggaaaacgctctatggt
gcaaacgtcatcatcttcgagggcatcatggcctttgctgacaagacactgctggagctc
ctggacatgaagatctttgtggacacagactctgacatccgccttgtgcgacggctgcgc
cgggacatcagcgagcgaggccgagacattgagggcgtcatcaagcagtacaacaagttc
gtcaaacctgccttcgaccagtacatccagcccaccatgcgtgtggcagacatcgtggtg
ccctgggggagcgggaacacagtggccatcgacttgatcgtgcagcacatgcacagccag
ctggaggagaggaagctgcgctgggatatggccgcactggcctcggcgcaccagtgccac
cctctgcctcagacgctgagtgtcctcgagagcacgccgcaggtgcgaggcatgcacacc
atcatcagggacaaggagaccagccgtgacgaattcatcttctactccaagcggttgatg
cggctgctcattgagcatgcgctctccttcctgcccttccaggtgcggggcgggccccgc
cacgagggcctgcttccttccccagggaacttcggtgaccgctacttcgggaccgacgct
gttcctgacggcagtgatgaggaagagtggcctccacgagcgagcctgagcgagcctgag
cgagcctga

KEGG   Panthera tigris altaica (Amur tiger): 102962326
Entry
102962326         CDS       T02988                                 

Gene name
UCK1
Definition
(RefSeq) uridine-cytidine kinase 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102962326 (UCK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102962326 (UCK1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     102962326 (UCK1)
SSDB
Motif
Pfam: PRK LTXXQ
Other DBs
NCBI-GeneID: 102962326
NCBI-ProteinID: XP_007078940
LinkDB
Position
Un
AA seq 256 aa
RAAPWREERVQAGILFVYSQSTVCEKIMELLGQNEVDHRQRKLVILSQDRFYKVLTAEQK
AKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVL
FEGILVFYSQEVRDMFHLRLFVDTDSDVRLSRRVLRDVHRGRDLEQILTQYTTFVKPAFE
EFCLPPHTESSLGGRVPPPPPGSTTFLSSALGSIPPAPRRPLVCTPPVSKPCGTSLAPCC
HVLGGSPPPARVAHLL
NT seq 771 nt   +upstreamnt  +downstreamnt
agggccgccccgtggcgggaggagcgggtccaggcgggaatcctgtttgtgtattcccag
tccactgtgtgtgagaagatcatggagctgctgggccagaacgaagtggaccaccggcag
cggaagctggtcatcctgagccaagataggttctacaaggtcctgactgcagagcagaaa
gccaaggcattgaagggccagtacaatttcgaccacccagatgcttttgataacgatttg
atgcacaggactctgaaaaacatcgtggagggcaaaaccgtcgaggtcccaacctatgat
tttgtgacccactccaggttaccggagaccacggtggtctaccctgcagatgtggtcctg
tttgagggcatcttggtgttctacagccaggaggtccgcgacatgtttcacctgcgtctc
ttcgtggacacggactcggacgtcaggctgtcgagaagagttctccgggacgtgcaccgc
gggagggatctggagcagattctgacccagtacaccaccttcgtgaagccggccttcgag
gagttctgcctgccgcctcacaccgagtccagcctgggtggccgtgtccctcccccaccc
cccgggagcacgacctttctcagctccgccttgggttccatccctcctgcccctcgccgt
cccctcgtctgcaccccaccagtgagcaaaccttgtggaaccagcctggccccctgttgt
cacgtcctcggtgggtccccaccgccggcccgtgtggctcatctcttgtga

KEGG   Panthera tigris altaica (Amur tiger): 102971572
Entry
102971572         CDS       T02988                                 

Gene name
UCK2
Definition
(RefSeq) uridine-cytidine kinase 2
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102971572 (UCK2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102971572 (UCK2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     102971572 (UCK2)
SSDB
Motif
Pfam: PRK Pox_D2 T3SS_needle_reg LTXXQ
Other DBs
NCBI-GeneID: 102971572
NCBI-ProteinID: XP_007078172
LinkDB
Position
Un
AA seq 247 aa
MTKSQGEAKPCVYAVPGKTSSVCAKIVQLLGQNEVDCRQKQVVILSQDSFYRVLTSEQKA
KALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLF
EGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFE
EFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQTNGYLNGYIPSRKRQSS
ESSSRPH
NT seq 744 nt   +upstreamnt  +downstreamnt
atgacaaagtcccaaggagaggcaaagccttgtgtctatgcagtgcctggcaaaacgtct
tccgtttgtgctaagattgtgcagctcctgggacagaatgaggtggactgtcgccagaag
caggtggttatcctgagccaggatagcttctaccgtgtcctcacttcggagcagaaggcc
aaagccttgaagggccagttcaattttgatcacccggatgcctttgacaatgaactcatc
ttcaaaacactcaaagaaatcactgaagggaaaacagtacagattcccgtgtatgatttt
gtctctcattcccggaaggaggagacggtcactgtctaccctgcagatgtggtgctcttt
gaagggatcctggccttctactcccaggaagtacgagacctgttccagatgaagcttttc
gtggacacagatgccgacacgcggctctcccgcagagtattaagggacatcagcgaaaga
gggagggaccttgagcagattttatctcagtacattacgttcgtcaagcctgcctttgag
gaattctgcttgccaacaaagaaatacgctgatgtgatcattcctagaggtgcagataat
ctagtggccatcaacctcatcgtgcagcacattcaggacatcctgaacggagggctctcc
aaacggcagaccaatggctatctcaacggctacatcccgtcacgcaagaggcagtcctcg
gagtccagcagccggccgcattga

DBGET integrated database retrieval system