KEGG   Panthera tigris altaica (Amur tiger): 102953403
Entry
102953403         CDS       T02988                                 

Gene name
DUT
Definition
(RefSeq) deoxyuridine triphosphatase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102953403 (DUT)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102953403 (DUT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102953403 (DUT)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     102953403 (DUT)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102953403 (DUT)
 Prokaryotic type
    102953403 (DUT)
SSDB
Motif
Pfam: dUTPase
Other DBs
NCBI-GeneID: 102953403
NCBI-ProteinID: XP_007081879
LinkDB
Position
Un
AA seq 235 aa
MTPVCPRPALGYHFFPCLLRSVFKDARSAAPRAEAAGPPRPLSSTRSLSRGRRGARLILS
PLVPSFLSFCSAMPCSEATPTISPSKRARPAEDAMRLCFVRLSEHATAPSKGSARAAGYD
LYSAYDYTVPPMEKVLVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNV
GVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
NT seq 708 nt   +upstreamnt  +downstreamnt
atgactcccgtctgccctcgcccggctctcggctaccatttctttccgtgtttgctccgc
tcagtgtttaaagacgcgcgcagcgcagcgccgagagcagaggccgcggggccgccccgg
ccgctgtccagcactcgcagcctgagtcggggccgccgcggcgccagactcattctgagt
ccacttgttccctcttttctctcgttctgctctgccatgccttgctctgaagcgacaccc
accatctcccccagcaagcgggctcggcctgcggaggacgccatgcggctctgctttgtc
cggctctcggagcacgccaccgccccgagcaaggggtctgcgcgggccgcgggctacgac
ctgtacagtgcctatgattatacagtaccacctatggaaaaagtccttgtgaaaacggac
attcagatagctcttccttctgggtgctatggaagagtagctccccgttctggcttggct
gcgaaacacttcatagatgtaggagctggcgtcatagatgaagattatagaggaaatgtg
ggtgttgtactatttaattttggcaaagaaaagtttgaagtcaaaaagggtgatcgaatt
gcacagctcatttgtgaacggattttttatccagaaatagaagaagttcaggttttggat
gacactgaaaggggttcaggaggttttggttctactgggaagaattaa

KEGG   Panthera tigris altaica (Amur tiger): 107181092
Entry
107181092         CDS       T02988                                 

Definition
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial-like
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    107181092
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107181092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    107181092
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     107181092
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    107181092
 Prokaryotic type
    107181092
SSDB
Motif
Pfam: dUTPase
Other DBs
NCBI-GeneID: 107181092
NCBI-ProteinID: XP_015399820
LinkDB
Position
Un
AA seq 175 aa
MPCSEATPTISPSKWARPAEDAMRLCFVWLSEPATAPSKRSVRAVGYDLYHAYDHTVPPM
EKALVKMDIQIALPSGCYGIGAPCSGLAAKHLRDVGAGIIGEDYRGNVGVLLNFGKEGAP
GWLSRLSVRLRFSLRKGDRIALLICEWIFYPEIEEVQVLDDTERGSGGLGSTGKN
NT seq 528 nt   +upstreamnt  +downstreamnt
atgccctgctctgaagcgacacccaccatctcccccagcaagtgggctcggcctgcggag
gacgccatgcggctctgctttgtctggctctcggagcccgccaccgccccgagcaagcgg
tccgtgcgggccgtgggctacgacctgtaccatgcctatgatcacacagtaccacctatg
gaaaaagcccttgtgaaaatggacattcagatagctcttccttctgggtgctatggaata
ggagctccctgttctggcttggctgcaaaacacctcagagatgtaggagctggcatcata
ggtgaagattatagaggaaatgtgggtgttctactaaattttggcaaagaaggggcgccc
gggtggctcagtcggttgagcgtccgacttcggttcagtttgagaaaaggtgatcgaatt
gcactgctcatttgtgaatggattttttatccagaaatagaggaagttcaggttttggat
gacactgaaaggggttcaggaggtttgggttctactgggaagaattaa

DBGET integrated database retrieval system