KEGG   Panthera tigris altaica (Amur tiger): 102953487
Entry
102953487         CDS       T02988                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04064  NF-kappa B signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04115  p53 signaling pathway
ptg04140  Autophagy - animal
ptg04141  Protein processing in endoplasmic reticulum
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04340  Hedgehog signaling pathway
ptg04510  Focal adhesion
ptg04621  NOD-like receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04915  Estrogen signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05014  Amyotrophic lateral sclerosis
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05215  Prostate cancer
ptg05222  Small cell lung cancer
ptg05226  Gastric cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102953487 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102953487 (BCL2)
   04630 JAK-STAT signaling pathway
    102953487 (BCL2)
   04064 NF-kappa B signaling pathway
    102953487 (BCL2)
   04066 HIF-1 signaling pathway
    102953487 (BCL2)
   04071 Sphingolipid signaling pathway
    102953487 (BCL2)
   04151 PI3K-Akt signaling pathway
    102953487 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102953487 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102953487 (BCL2)
   04215 Apoptosis - multiple species
    102953487 (BCL2)
   04217 Necroptosis
    102953487 (BCL2)
   04115 p53 signaling pathway
    102953487 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102953487 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102953487 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102953487 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    102953487 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102953487 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    102953487 (BCL2)
   04722 Neurotrophin signaling pathway
    102953487 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953487 (BCL2)
   05206 MicroRNAs in cancer
    102953487 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102953487 (BCL2)
   05226 Gastric cancer
    102953487 (BCL2)
   05215 Prostate cancer
    102953487 (BCL2)
   05222 Small cell lung cancer
    102953487 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102953487 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102953487 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102953487 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102953487 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102953487 (BCL2)
   05152 Tuberculosis
    102953487 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102953487 (BCL2)
   05161 Hepatitis B
    102953487 (BCL2)
   05162 Measles
    102953487 (BCL2)
   05168 Herpes simplex virus 1 infection
    102953487 (BCL2)
   05169 Epstein-Barr virus infection
    102953487 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102953487 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102953487 (BCL2)
   01524 Platinum drug resistance
    102953487 (BCL2)
   01522 Endocrine resistance
    102953487 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102953487 (BCL2)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102953487 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102953487
NCBI-ProteinID: XP_007096156
LinkDB
Position
Un
AA seq 173 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAAAAAGPALSPVPPVVHLTLRQAGDD
FSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGACPLECGLDVTDLRLRIRG
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgacaaccgggagatagtcatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggggacgccgccgccgccgcgggc
cctgcgctcagccctgtgccacctgtggtccacctgaccctgcgccaggccggcgatgac
ttctcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacaccc
tttaccgcaaggggacgctttgccacggtggtggaggagctcttcagggatggagtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
cgagagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg
cacctgcacacctggatccaagacaacggaggctgggtaggtgcatgtccgcttgaatgt
gggctggacgttaccgatctgaggctgagaatccgtggttga

DBGET integrated database retrieval system