Panthera tigris altaica (Amur tiger): 102953487 Help Entry 102953487         CDS       T02988                                  Gene name BCL2 Definition (RefSeq) BCL2, apoptosis regulator   KO K02161   apoptosis regulator Bcl-2 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01521   EGFR tyrosine kinase inhibitor resistance ptg01522   Endocrine resistance ptg01524   Platinum drug resistance ptg04064   NF-kappa B signaling pathway ptg04066   HIF-1 signaling pathway ptg04071   Sphingolipid signaling pathway ptg04115   p53 signaling pathway ptg04140   Autophagy - animal ptg04141   Protein processing in endoplasmic reticulum ptg04151   PI3K-Akt signaling pathway ptg04210   Apoptosis ptg04215   Apoptosis - multiple species ptg04217   Necroptosis ptg04261   Adrenergic signaling in cardiomyocytes ptg04340   Hedgehog signaling pathway ptg04510   Focal adhesion ptg04621   NOD-like receptor signaling pathway ptg04630   JAK-STAT signaling pathway ptg04722   Neurotrophin signaling pathway ptg04725   Cholinergic synapse ptg04915   Estrogen signaling pathway ptg04928   Parathyroid hormone synthesis, secretion and action ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg05014   Amyotrophic lateral sclerosis ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05161   Hepatitis B ptg05162   Measles ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05206   MicroRNAs in cancer ptg05210   Colorectal cancer ptg05215   Prostate cancer ptg05222   Small cell lung cancer ptg05226   Gastric cancer ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102953487 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     102953487 (BCL2)    04630 JAK-STAT signaling pathway     102953487 (BCL2)    04064 NF-kappa B signaling pathway     102953487 (BCL2)    04066 HIF-1 signaling pathway     102953487 (BCL2)    04071 Sphingolipid signaling pathway     102953487 (BCL2)    04151 PI3K-Akt signaling pathway     102953487 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102953487 (BCL2)   09143 Cell growth and death    04210 Apoptosis     102953487 (BCL2)    04215 Apoptosis - multiple species     102953487 (BCL2)    04217 Necroptosis     102953487 (BCL2)    04115 p53 signaling pathway     102953487 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102953487 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102953487 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     102953487 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     102953487 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102953487 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     102953487 (BCL2)    04722 Neurotrophin signaling pathway     102953487 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102953487 (BCL2)    05206 MicroRNAs in cancer     102953487 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     102953487 (BCL2)    05226 Gastric cancer     102953487 (BCL2)    05215 Prostate cancer     102953487 (BCL2)    05222 Small cell lung cancer     102953487 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102953487 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     102953487 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102953487 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102953487 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     102953487 (BCL2)    05152 Tuberculosis     102953487 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102953487 (BCL2)    05161 Hepatitis B     102953487 (BCL2)    05162 Measles     102953487 (BCL2)    05168 Herpes simplex virus 1 infection     102953487 (BCL2)    05169 Epstein-Barr virus infection     102953487 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102953487 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102953487 (BCL2)    01524 Platinum drug resistance     102953487 (BCL2)    01522 Endocrine resistance     102953487 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptg01009]     102953487 (BCL2) Protein phosphatases and associated proteins [BR:ptg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102953487 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102953487 NCBI-ProteinID:  XP_007096156 LinkDB All DBs Position Un AA seq 173 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAAAAAGPALSPVPPVVHLTLRQAGDD FSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGACPLECGLDVTDLRLRIRG NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgacaaccgggagatagtcatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggggacgccgccgccgccgcgggc cctgcgctcagccctgtgccacctgtggtccacctgaccctgcgccaggccggcgatgac ttctcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacaccc tttaccgcaaggggacgctttgccacggtggtggaggagctcttcagggatggagtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac cgagagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg cacctgcacacctggatccaagacaacggaggctgggtaggtgcatgtccgcttgaatgt gggctggacgttaccgatctgaggctgagaatccgtggttga

DBGET integrated database retrieval system