KEGG   Panthera tigris altaica (Amur tiger): 102953595Help
Entry
102953595         CDS       T02988                                 

Gene name
CD19
Definition
(RefSeq) CD19 molecule
  KO
K06465  B-lymphocyte antigen CD19
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04151  PI3K-Akt signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04662  B cell receptor signaling pathway
ptg05169  Epstein-Barr virus infection
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102953595 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102953595 (CD19)
   04662 B cell receptor signaling pathway
    102953595 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102953595 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102953595 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102953595 (CD19)
CD molecules [BR:ptg04090]
 Proteins
  102953595 (CD19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 102953595
NCBI-ProteinID: XP_007084143
LinkDB All DBs
Position
Un
AA seq 558 aa AA seqDB search
MPPPLLLFFLLFLTPEGVRPQKTLLVEAKEGGKAELPCLKGPSDGPPEQQAWFQGAQSEL
DPGSQGLGIQKGPLGLQLLIFNVSDQMGGFYVCQLGPPSEQAWQSGWTVSVEGSGELFRW
NASYLNDPGCGLGNRSSEGPKPSSGYPTSSQLYVWAKGHPEIWETDPECASPRGSLNQSL
NQDLTVAPGSTFWLPCEVPPASVARGPISWTLVRPKKHNISLLHLNLREDAPVREMWVLD
TLRGGAVLLLPQATARDAGTYHCYHGNMTIEMQLKVTAQSVRHWLLEAGGWKVPVVPLLY
LIICLGSLVSFVHLRRALILRKKRKRMTDPTRRFFKVTPSPGSGSQNQYGNVLSLPTPTS
GTGRRHRPLSDSKLEPHPFSPVTPIPXGPGLPQLRAPPSGKSPEEEEGEAYEEPDSEEGS
EFYENDSNLGQDQLSQDGSGYENPEDDALGPGDEDSFSSAESYENEDEELAEPVARTADF
LSPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSLRAQPGPNHEEDADSYENMDNPN
GPEPAWGGGGRMGTWNTR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcctcttctcctcttcttcctcctcttcctgacccctgagggagtcaggccc
cagaaaacactgctggtggaggctaaagagggaggcaaagctgagctgccatgcctcaaa
ggtccctcagatggtccccctgagcagcaggcctggtttcagggggctcagtcagagctg
gacccaggttcacaaggcctgggcatccagaaggggcccctgggcctccagctcctcatc
ttcaacgtctctgaccagatggggggcttctacgtgtgccagctggggcccccttctgag
caggcctggcagtctggctggacagtcagcgtggagggcagcggggagctgttccgctgg
aatgcttcatacctaaatgacccaggctgtggcctggggaacaggtcctcagagggcccc
aagccctcttctggttaccccacaagctcccagctgtacgtgtgggccaaaggccaccct
gagatctgggagacagaccctgaatgtgcctcgcccaggggcagtctgaaccagagcctc
aaccaagacctcaccgtggcccctggctccacattctggctgccctgtgaggtgccccct
gcctccgtggccagaggccccatctcctggaccctcgtgcgccccaagaagcataacatc
tcattgctgcacttaaacctgagggaggatgccccggtcagagagatgtgggtcctagac
accctcaggggaggggctgttctgttgctgccccaggccaccgctcgagacgctggcacc
tatcattgttaccatggcaacatgaccatcgagatgcagctgaaggtcactgcccagtca
gtaagacactggctgctggaggctggtggctggaaagtccccgttgtgccattactttat
ctgatcatctgcctgggttccctggtgagctttgttcatcttcgaagagccctgatcctc
aggaagaaaagaaagcgaatgaccgatcccaccagaaggttcttcaaagtgacgccttcc
ccgggaagcgggtcccagaatcagtacgggaacgtgctctcccttcccacgcccacctct
gggacgggtaggaggcaccgcccactctctgactccaagctagaaccccacccattttcc
ccggtcactccaatcccctgagggcccggccttccccagctccgagcgccgccttcagga
aaaagcccagaagaagaggaaggggaagcctatgaggagccggacagtgaggagggctcc
gagttctacgagaatgactccaacctcgggcaggaccaactctcccaggatggcagcggc
tatgagaaccctgaggacgacgccttgggtcccggggatgaagactccttctccagcgcc
gagtcttatgagaatgaggatgaagagctggctgagccagtcgccaggacagcagacttc
ctgagcccccatgggtctgcctgggatcccagcagggaggcaacctctcttgggtcccag
tcctacgaggatatgagagggatcctgtatgcagccccccagctccgctcccttcgggcc
cagccgggtcctaatcatgaggaagatgcagactcttatgagaacatggacaatcccaat
gggccagaaccagcatggggaggagggggccgcatgggcacctggaacactaggtga

DBGET integrated database retrieval system