KEGG   Panthera tigris altaica (Amur tiger): 102953620Help
Entry
102953620         CDS       T02988                                 

Gene name
ICOS
Definition
(RefSeq) inducible T-cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04514  Cell adhesion molecules (CAMs)
ptg04660  T cell receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    102953620 (ICOS)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102953620 (ICOS)
   04672 Intestinal immune network for IgA production
    102953620 (ICOS)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102953620 (ICOS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102953620 (ICOS)
CD molecules [BR:ptg04090]
 Proteins
  102953620 (ICOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2
Motif
Other DBs
NCBI-GeneID: 102953620
NCBI-ProteinID: XP_007090024
LinkDB All DBs
Position
Un
AA seq 209 aa AA seqDB search
MKLDLCYFLLFCFQVEVLTGEINDSAKSEMFTFHDGGIQISCKFSEIALQFKMKLLKGTE
VLCDLTKTKESGNTVSIKNLKFCQTQLFNDSVSFFLYNLDNSHASYYTCELSIFDPPPFQ
KKNISREYLNIYESQICCQLKFWLPIGCSAFVVVYIFGCVFLCWLTKKKYRSSGHDPNSE
YMFMAAVNTAKKPGLTGVTHNLELCGTQA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagacctctgctatttccttctcttctgctttcaagttgaagtcctaacagga
gaaatcaatgattctgccaagtccgagatgtttacctttcacgatggaggcatacaaatt
tcatgcaaattcagtgagatagccttgcaatttaaaatgaagttgctaaaagggacggaa
gtactctgtgatctcacgaagacaaaagaaagtggtaacacggtgtccattaagaatctg
aaattctgtcaaactcagttattcaatgacagtgtctcctttttcctgtataatttggac
aattctcatgccagctattacacctgcgaactgtcaatttttgatcctcctccttttcag
aagaagaatattagcagagaatatttgaatatttatgaatcacagatttgctgccagctg
aagttctggttacccatagggtgttcagcttttgttgtagtctacatttttggatgcgta
tttctttgttggcttacaaaaaagaagtatcgatccagtgggcatgaccctaacagtgaa
tacatgtttatggcagcagtgaacacagccaagaaacctggactcacaggtgtgactcat
aatttggaactttgtggcacccaggcatga

DBGET integrated database retrieval system