KEGG   Panthera tigris altaica (Amur tiger): 102953665
Entry
102953665         CDS       T02988                                 

Gene name
PGD
Definition
(RefSeq) phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00030  Pentose phosphate pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
Module
ptg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102953665 (PGD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102953665 (PGD)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     102953665 (PGD)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     102953665 (PGD)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 Sas6_CC
Other DBs
NCBI-GeneID: 102953665
NCBI-ProteinID: XP_015391340
LinkDB
Position
Un
AA seq 470 aa
MGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAHSLEEMVSKLKKPRRIIL
LVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCQTLKAKGILFVGSGVSGGEE
GARYGPSLMPGGDKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYG
DMQLICEAYHLMKDVLEMGHDEMAKAFEEWNKTELDSFLIEITANILKFQDSDGKHLLPK
IRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERVQASQKLKGPQKIQFE
GDKKSFLEDIQKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFL
GKIKDAFDRNPRLQNLLLDDFFKSAVENCQDSWRRTVSTGVRAGIPMPCFTTALSFYDGY
RHEMLPANLIQAQRDYFGAHTYELLANPGRFIHTNWTGHGGSVSSSSYNA
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgggccagaacttaattttgaacatgaatgaccatggcttcgtggtttgtgcttttaat
aggacggtctccaaagtggatgatttcttggccaacgaggcaaagggaaccaaggtggtc
ggagcacactccttggaggagatggtctccaagctgaagaaaccgcggcgcatcatactg
ctggtgaaggctggccaagccgttgatgatttcattgaaaaactggtaccattgttggac
actggtgacatcatcattgatggaggaaattctgaatacagggataccacaagacgatgt
caaaccctcaaggccaagggaatcctgtttgtggggagcggagtcagtggcggagaggaa
ggggcccgctatggcccctcacttatgccaggaggtgacaaagaagcctggccccacatc
aagacaatcttccaaggcatcgctgcaaaagtaggaactggggaaccgtgctgtgactgg
gtgggagatgaaggagcgggacacttcgtgaagatggtgcacaacgggatagagtacggg
gacatgcagctcatctgtgaggcctaccacctgatgaaagatgtgctggagatggggcac
gacgagatggcgaaggcatttgaggaatggaataagaccgagctcgactcgttcctgatt
gaaatcacagccaacatcctcaagttccaagacagcgacggcaaacacctgctgccgaag
atcagggacagcgcggggcagaagggcacagggaagtggactgccatctcggccctggag
tacggcgttcctgtcaccctcatcggagaggcagtttttgctcggtgcttatcatctctg
aaggacgagagggttcaagccagccaaaagctgaagggtccccaaaagatccagtttgaa
ggtgataagaaatcattcctggaggacattcagaaggccctgtatgcttccaagatcatc
tcgtacgcgcaaggctttatgctgctgagacaagccgccacggaattcggctggaccctt
aactacggtggcatcgccctgatgtggagggggggctgcatcatcaggagcgtgttccta
ggaaagataaaagacgcattcgatcggaacccacgccttcagaatctactactggatgac
ttttttaagtctgctgttgaaaactgccaggactcctggcggcggacggtgagcaccggt
gtccgggcgggcatccccatgccctgcttcaccaccgccctctccttctacgacggctac
agacacgagatgctgcccgccaaccttatccaggctcagcgggattacttcggggctcac
acttacgaactcttagccaaccccggacggttcatccacaccaactggacaggccacggt
ggcagcgtgtcgtcctcttcctacaatgcctga

DBGET integrated database retrieval system