KEGG   Panthera tigris altaica (Amur tiger): 102953819
Entry
102953819         CDS       T02988                                 

Gene name
ATP7A
Definition
(RefSeq) ATPase copper transporting alpha
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102953819 (ATP7A)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102953819 (ATP7A)
Enzymes [BR:ptg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     102953819 (ATP7A)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD_2
Other DBs
NCBI-GeneID: 102953819
NCBI-ProteinID: XP_015396877
LinkDB
Position
Un
AA seq 1496 aa
MVVDLVTISVEGMTCGSCVWTIEQRIGKLNGVHHIKVSLEEKNATIIYDPKLQTPKTLQE
AIDDMGFDAVLHNPNPVPVLTDTVFLTVAASLTLPWDHIQSILLKTKGVTDIKISPQQRT
VVVTIIPSILNANQIIELLPDLSLDIGTLEKKSGTCEDYSMAQVGEVMLKMKVEGMTCHS
CTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAVGFPAFIKKQPKY
LKLGAIDIERLKNTPVKSSEGSQQRSPSYSSDSTVTFIIDGMHCKSCVLNIESALSTLQY
VSSIVVSLENRSAIVKYNASSVTPETLRKAIEAISPGQYRVSIISEVESTSNSPSSSSLQ
KIPLNTVSHPLTQETVINIGGMTCNSCVQSIEGVISKKAGVKSIRVSLANGNGTVEYDPL
LTSPETLREAIEDMGFDAALSDTNEPLVIIAQTSSEMPLLTSTNEFYTKTMTPIHDGEVK
PSSKCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNSAIIQPPVIAEF
IRELGFGATMIENADEGDGVLELVVRGMTCASCVHKIESILTKHRGIFYCSVALATNKAH
IKYDPEIIGPRDIIHTVESLGFEASLVKKDRSASHLDHKREIRQWRRSFLVSLFFCIPVM
GLMIYMMVMDHHLATLHHNQSMSQEEMISIHSSSMFLERQILPGLSIMNLLSFLLCVPVQ
FFGGWYFYIQAYRALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTP
PMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQR
GDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKSGSTVIAGSINQNGSLLIRA
THVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVVISIATLLVWIIIGFLNF
EIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGI
LIKGGEPLEMAHKVKVVVFDKTGTITHGTPIVNQVKVLVESNRISRNKILAIVGTAESNS
EHPLGAAITKYCKQELDTETLGTCVDFQVVPGCGISCKVINIEGLLHKNNWRIEENNIKN
ASLVQIGANNEQSSTSSSMIIDAQLSNALNAQQYKVLIGNREWMIRNGFVINNDVDDSMT
EHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSI
ASQVGITKVFAEVLPSHKVAKVKQLQEEGKQVAMVGDGINDSPALAMANVGIAIGTGTDV
AIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVL
QPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARSHMGQKRPSEISVHVGIDDTS
RNSPKLGLLDRIVNYSRASINSLLSDKRSLNSIGTSEPDKHSLLVGDCREDDDTTL
NT seq 4491 nt   +upstreamnt  +downstreamnt
atggttgtggatttggtcaccatctctgttgaggggatgacatgtggttcctgtgtttgg
accattgagcagcggattggaaaactgaatggcgtacatcatattaaagtttcactggaa
gaaaaaaatgcaactattatttatgaccctaaactacagactccaaagaccctccaggaa
gctattgatgacatgggctttgatgctgttctccacaatcctaaccctgtccctgtttta
actgacactgtgtttctgactgttgctgcttcactgactctgccatgggaccatatccaa
agcatattgctcaagaccaagggtgtgacagacattaaaatttcccctcagcaaagaact
gtagtggtgacaataatcccttctattctgaatgccaatcagataatagagctgcttccg
gatctcagtttagatattggaactctggagaaaaagtcaggaacttgtgaagattatagt
atggctcaagtaggtgaagtcatgctgaagatgaaagtagaaggaatgacctgccattca
tgcaccagcaccattgaaggaaaaattgggaagctgcaaggtgttcagcgaattaaagtc
tccttggacaaccaagaagctactattgtttatcaacctcatcttatcacagcagaggaa
attaaaaaacagattgaagccgtgggctttccagcattcatcaaaaaacagcccaagtac
ctcaaattgggagctattgatatagaacgtctaaagaatacaccagtcaaatcctcagaa
ggatcacagcaaaggagtccatcatatagcagtgattcaacagtcactttcattatagat
ggcatgcattgtaaatcatgtgtgttaaatattgaaagtgctttatctacactccaatat
gtaagcagcatcgtagtttctttagagaatagatctgccatagtgaagtacaatgcaagc
tcagtcactccagaaacccttagaaaagcaatagaggccatctcaccagggcaatacaga
gttagtattataagtgaagttgaaagtacctcaaactctccctccagctcatctcttcaa
aagattcctttgaacacagtaagccatcctctgactcaagaaactgtgataaacattggt
ggcatgacttgtaattcttgtgtgcagtctattgagggtgtcatatcaaaaaaggcaggt
gtaaaatccatacgagtatctcttgcaaatggcaatgggactgttgagtatgatcctcta
ctaacttctccagagaccttgagagaagcaatagaagacatgggatttgatgctgccttg
tcagatacaaatgagccattggtaataatagctcagacctcatcagaaatgccgcttttg
acctcaactaatgaattttatactaaaacgatgacaccaattcacgatggggaagtaaag
ccttcgtctaagtgttatatacaggtcactggtatgacttgtgcttcctgtgtagcaaac
attgaacggaatttaagacgagaagaaggaatatattctgtacttgtggctctgatggct
ggcaaagcagaagtaagatataattctgctattatacaacccccagtgatagctgagttc
atccgagagcttggatttggagccactatgatagaaaatgctgatgaaggagatggtgtt
ttggaacttgttgtgagaggaatgacgtgtgcctcctgtgtacataaaatagagtctatc
ctcacaaaacacagagggatcttctactgttctgtggccttggcaaccaacaaagcacat
attaagtatgacccagaaattattggtcccagggatattatccatacagttgaaagctta
ggttttgaagcttctttggtcaaaaaggatcggtcagcaagccacctggaccataaacga
gaaataagacagtggagacggtccttccttgtgagcctctttttctgtattcctgtcatg
gggctgatgatatatatgatggttatggaccaccatcttgcaactcttcaccataatcag
agcatgagtcaagaagaaatgatcagcattcattcttcttctatgttcctggagcgccag
atcctgccaggactgtccattatgaatttgctatcctttttgttgtgtgtacctgtacag
ttttttggaggctggtacttctacattcaggcgtatagagccctgaagcataaaactgca
aatatggatgtactgattgtgctggcaaccaccattgcttttgcctactctttggttatt
cttctggttgcaatgtatgaaagagccaaagtaaaccctattactttctttgacacacct
cctatgctatttgtctttattgcactaggccggtggctggaacatatagcaaagggcaaa
acatcagaggctcttgccaagctaatttcactacaagctacagaagcaactattgtaact
cttgactctgataatattctcttaagtgaagaacaagtggatgtggaacttgtacaacgt
ggagacatcattaaagtggttccaggaggcaaatttccagtggatggtcgtgtgattgaa
ggacattctatggtagatgagtcccttatcacaggggaggcaatgccagtggctaagaaa
tctggcagcacagtgattgctggttccattaaccagaatgggtcactacttatccgtgca
acccatgttggagctgacacaacactttctcaaattgtcaaacttgtggaagaggcacaa
acatcaaaggctcctatccagcagtttgcagacaaactaagtggctactttgttcctttt
attgttgtcatttccattgctaccctcctggtttggattataattggatttctgaatttt
gaaattgtggaaacctactttcctggatataacagaagtatctctcgaacagaaacgata
atacgctttgctttccaagcctctatcacagttctgtgtattgcgtgcccctgttcactg
ggactagccactccaactgctgtgatggtgggtacaggagtaggtgctcaaaatggcata
ctaatcaaaggtggggagccactggagatggctcataaggtaaaggtagtggtatttgat
aagactggaaccattacccatggaactcctatagtgaatcaagtaaaggttctagttgaa
agtaacagaatatcacgtaataagatcctggccatcgtgggaactgctgaaagtaacagt
gaacaccctctaggagcagccataacgaagtactgcaaacaggagctggacactgaaacc
ttgggtacctgtgtagatttccaggttgtgccaggctgtggtattagctgtaaagtcatc
aatattgaaggcttgctacataagaataactggaggatagaggaaaataatattaaaaat
gcatccctggttcaaattggcgcaaataatgaacagtcatcaacttcatcttccatgatt
attgatgcccagctctcaaatgctcttaatgctcaacagtacaaagtcctcattggtaac
cgggaatggatgattagaaatggttttgttattaataatgatgtagatgattccatgact
gaacatgagagaaaaggtcggactgctgtattggtggccgttgatgatgagctgtgtggt
ttgattgctattgctgatacagtgaagcctgaagcagaattggctgtccatattttgaaa
tccatgggcttagaagtagttctgatgactggagacaacagtaaaacagctagatctatt
gcttctcaggttggcattactaaggtgtttgctgaagttctcccttctcataaggttgct
aaggtgaagcaacttcaggaggaggggaaacaggttgcaatggtaggagatggaatcaat
gactctccagctctggcaatggctaatgttggaattgccattggcacaggtacagatgta
gccattgaagcagctgatgtggttttaataaggaatgatcttctggatgtagtggcaagt
attgacttatcaaggaagacagtcaagaggattcggataaattttgttttcgctctaatt
tataatctagttggaattcccatagctgctggagtttttatgcccattggtttggttttg
cagccctggatgggatctgctgcaatggctgcttcatctgtttcagtagtactttcttct
ctcttccttaaactttatagaaaaccaacttatgagaattatgaactgcatgcccgaagc
cacatgggacagaaaaggccttcggaaatcagcgttcatgttggaatagatgacacctca
agaaattctcctaaactgggtttgctggaccggattgttaattacagcagagcctccata
aattcactactgtctgataaacggtccctaaacagcattggtaccagtgaacctgacaag
cattcacttctggtgggagactgcagggaagatgatgacaccacattgtaa

KEGG   Panthera tigris altaica (Amur tiger): 102957472
Entry
102957472         CDS       T02988                                 

Gene name
ATP7B
Definition
(RefSeq) ATPase copper transporting beta
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102957472 (ATP7B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102957472 (ATP7B)
Enzymes [BR:ptg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     102957472 (ATP7B)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD_2 HAD
Other DBs
NCBI-GeneID: 102957472
NCBI-ProteinID: XP_007097763
LinkDB
Position
Un
AA seq 1436 aa
MQQKQSFAFDNVGYEGGLDSVCPSQTTTGTISISGMTCQSCVKSIEGRISSLKGIVSIKV
SLEQGSVTVSYVPSVLSLPQVCRHIEDMGFEASITEGKAASWPSRSSSALEATVKLRVEG
MTCQSCVSSIEGRLGKLQGVVRARVSLGTQEAVITYQPYLIQPQDLRDHINDMGFEAVIK
NRVAPVSLGPIDIGRLQRTNPKTPLTSGTQNLNNSETLGHQGSRVVTLQLRVDGMHCKSC
VLNIEENIGQLPGVQSIQVSLENRIAQVQFDPSRVTPGALQRAIEALPPGNFQVSLPDGA
AGSGTDNSPSTHLAPAPAPAQGTRMQGLCSTVVLAIGGMTCASCVQSIEGLLSRREGVRR
VSVSLTEGTGVVLYDPSVINPEGLRAAVEEMGFKASVVSENCYSNHVGNRSAGNSTVHTT
AGGPVSVQGTAPHAGGLPKNHNPGSSSKSPQASTAVAPQKCFLQITGMTCASCVSNIERN
LQKEAGILSVLVALMAGKAEIKYNPEVIQPLEIAQLIQDLGFEAAVMENYTGSDGDLELI
ITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEMIGPRDIVKIIEEIGFHA
SPAQRNPNVHHLDHKVEIKQWKKSFLCSLMFGIPVMGLMIYMLVPSNEPHETMVLDHNIV
PGLSILNLIFFILCTFVQLLGGWYFYIQAYRSLRHGAANMDVLIVLATSIAYTYSVIILV
VAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLG
EDNLIIREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGSTMADESLITGEAMPVTKKPG
STVIAGSINAHGSVLINATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFII
IISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGL
ATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLADVA
TLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNV
EGIVAHGKRQWSTQAGVSNGVGGVPEETDATPQTFSVLIGNREWMRRNGLTISSDISDTM
TDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVLITGDNRKTARA
IATQVGINKVFAEVLPSHKVAKVQELQNEGKRVAMVGDGVNDSPALARADVGIAIGTGTD
VAIEAADVVLIRNDLLDVVASIHLSKRTVWRVRLNLVLALIYNLIGIPIAAGVFMPIGIV
LQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERYEAQAQGHMKPLTASQVSVHIGMDDR
RRDSPRATPWDQVSYISQVSLSSLKSDRLSRHSAGADDNGDKWSLLLNDRDEEQCI
NT seq 4311 nt   +upstreamnt  +downstreamnt
atgcagcagaagcagagtttcgcctttgacaatgttggctacgagggtggtctggacagc
gtgtgcccctctcagacgaccaccggcaccatcagcatttcgggcatgacttgccagtcg
tgtgtaaagtctatcgagggcaggatttcgagtttgaaaggcatcgtgagcattaaggtt
tccctggaacaaggcagcgtgactgtgagctatgtgccgtcagtcctgagcctgccacag
gtttgccgtcacatcgaggacatgggcttcgaggccagcatcacagaaggaaaggccgcc
tcctggccctcgagatcctcgtctgccctggaggccacggtcaagcttcgggtggagggc
atgacctgccagtcctgtgtcagctccatcgaaggcaggctggggaagctgcaaggggta
gtgagggcccgagtctcccttggcacccaggaggcagtcattacttaccagccttatctc
attcagccccaagacctcagggaccacataaacgacatgggatttgaagctgtcatcaag
aacagagtggcacccgtaagcctgggaccaattgatattgggcggctacagaggaccaac
ccaaagacccctttgacgtctggtacccagaatctcaataactctgagaccttggggcac
caagggagccgtgtggtcaccctgcaactgagagtagatggaatgcactgtaaatcttgt
gtcctgaatattgaagaaaatataggtcaactcccaggcgttcaaagtattcaagtgtcc
ttggagaacagaattgcccaagtacagtttgacccttctcgtgtcacccccggggccctg
cagagggccattgaggctcttcctcctgggaactttcaagtttctcttcctgacggagca
gcagggagtggcacggataacagcccttccacgcatctcgcccccgcccccgcccccgcc
cagggaacccggatgcagggcctgtgcagtaccgtggtgcttgccattggtggcatgacc
tgtgcgtcctgcgtccagtccatcgaaggcctgctctcccgcagggaaggggtgcggcga
gtatcagtctctctgactgaagggactggagtggtgctctatgatccctctgtaattaac
ccggaaggactccgagctgctgttgaagaaatgggattcaaggcgtcagtcgtttctgaa
aactgttacagcaaccatgttgggaaccgcagcgcaggtaattccacagtgcacaccaca
gctggcggacctgtgtctgtgcagggaacggctccccatgctggggggctccctaagaac
cacaaccccggcagctcgtcaaagtccccgcaggcctctacagcagtggcaccacagaag
tgctttttacagatcacaggcatgacctgtgcatcctgtgtgtctaacatagagagaaac
cttcagaaagaggcaggtattctctcggtgctggtcgccttgatggctggaaaggcagag
attaagtacaatccggaagtcatccagccgctggagatagctcagctcatccaggacttg
ggctttgaggctgcagtaatggaaaactacacaggctcagatggtgacctcgagctgatc
atcacgggcatgacctgtgcatcctgcgttcacaacatagagtccaaactcaccagaacg
aacggcatcacctacgcctctgtggcccttgccaccagcaaagcccacgtgaagtttgat
cctgaaatgattggtccgcgggatattgtcaagattatcgaggaaatcggctttcatgct
tccccggcccagagaaaccccaacgtgcatcacttggaccacaaggtggaaataaagcag
tggaagaagtcttttctgtgcagcctgatgtttggcatccctgtcatgggtttaatgatc
tatatgttggtgcccagcaatgagccccacgagacaatggtcctggaccacaacatcgtt
ccaggactgtccattctaaatctcatcttctttatcctgtgcaccttcgtccagctcctt
ggcgggtggtacttctacatccaggcctacagatctctgcggcatggggcggccaacatg
gacgtgctcatcgtgctggccacgagcatcgcctatacctactcagtcatcatcctggtg
gtggccgtggctgagaaggcggagagaagccccgtgaccttctttgacaccccccccatg
ctctttgtgttcattgccctgggccggtggctggaacacgtggcgaagagcaaaacctca
gaagcccttgccaaactcatgtctctccaagccacagaagccaccgttgtgacccttggc
gaggacaacttgatcatcagagaggagcaagtacccatggagctggtgcagcggggcgac
gtcatcaaagtcgtccccggcggaaagttcccggtggatgggaaagtcctggaaggcagt
accatggctgacgagtctctcatcacaggagaagccatgcctgtcactaagaaacccgga
agcacagtgattgctgggtctataaacgcacatggctctgtgctcattaacgccacccac
gtgggcaatgacaccactttggctcagattgtgaaattagtagaagaggctcagatgtca
aaggcacccattcagcaactggctgaccggtttagtggatattttgtcccatttatcatc
atcatttccacgttgacgttggtggtatggattataatcggttttatcgattttggtgtt
gttcagaaatactttcctacccccaacaagcacatctcccagacagaggtgatcatccgg
tttgcgttccagacatccatcacggtgctctgcattgcctgcccctgctcgctgggcttg
gccacacccacggcggtcatggtgggcaccggggtggccgcccagaatggcatcctcatc
aagggaggcaagcctctggaaatggcccacaagataaagactgtgatgtttgacaaaact
ggcaccattacccacggggtccccaaggtcatgagggtcctcctgctcgcggatgtggcc
acgctgcccctcaggaaggttcttgctgtggtggggactgcggaggccagcagcgagcac
cccctgggtgtggcggtcaccaagtactgtaaagaggagctgggaacagagaccttgggg
tactgcacagacttccaggcggtgccaggctgcggaattggctgtaaagtcagcaacgtg
gagggcatcgtggcccatggcaagcgccagtggagcacacaggctggggtctcaaacggc
gttggcggtgtccctgaggagacagatgcaaccccccagaccttctctgtgctgattggg
aaccgcgaatggatgaggcgcaacggcttaaccatttccagcgacatcagtgacactatg
acagatcacgagatgaaaggccagacagccatcctggtggccatagatggcgtgctctgc
gggatgattgccatcgcggatgctgtcaagcaggaggcagccctggccgtgcacacgctg
aagagcatgggcgtggacgtggttctgatcactggggacaaccggaagaccgccagagcc
attgccacccaggttggcatcaacaaagtctttgcagaggtgctgccttctcacaaggtg
gccaaggtccaggagctccagaatgaagggaagagagtcgccatggtgggagatggggtc
aacgactcgccggccttggcccgggccgacgtgggcattgccatcgggacaggcacagat
gtcgccattgaggctgctgacgttgtcctcatcagaaacgacttgctcgacgtggtggcg
agcattcacctctccaagaggaccgtctggagagtacgactcaatctggtgctggcattg
atttataatctgatcgggatacccatcgcagcaggggtcttcatgcccatcggcatcgtg
ctacagccgtggatgggctcagcggccatggcggcctcctccgtgtctgtggttctctcg
tcgctgcaactcaagtgctataagaagcccgacctggagaggtatgaggcccaggcccag
ggccacatgaagcccctgactgcgtcccaggtcagcgtgcacattggcatggatgaccgg
cgacgggactcaccgagggccacgccctgggaccaggtcagctacatcagccaggtgtct
ctgtcctcactgaagtcggacaggctgtctcggcacagtgctggggctgacgacaatggg
gacaaatggtctctgctcctgaatgacagagatgaggagcagtgcatctga

DBGET integrated database retrieval system