KEGG   Panthera tigris altaica (Amur tiger): 102953855
Entry
102953855         CDS       T02988                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102953855 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102953855 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102953855 (GPX7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102953855 (GPX7)
   05016 Huntington disease
    102953855 (GPX7)
   05022 Pathways of neurodegeneration - multiple diseases
    102953855 (GPX7)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102953855 (GPX7)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 102953855
NCBI-ProteinID: XP_007077259
LinkDB
Position
Un
AA seq 167 aa
DARAIQANCYLITKSLREDSEKKCTWVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN
VLAFPCNQFGQQEPDSNKEIESFARRTYGVSFPMFSKVAVTGTGAHPAFKYLIQTSGKEP
TWNFWKYLVAPDGKVVGAWDPTVSVEEIRPQITALVRKLILKKREDL
NT seq 504 nt   +upstreamnt  +downstreamnt
gatgcaagagccatccaggctaactgctatctcattaccaagtctctcagagaggactca
gagaagaaatgtacctgggtgtccctggtagtgaacgtggctagcgagtgcggcttcaca
gaccagcactacagagccttgcagcagctgcagcgggacctggggccccatcacttcaat
gtgcttgcgttcccctgcaaccagtttggccagcaggagcccgatagcaacaaggagatc
gagagcttcgcccgccgcacctatggtgtctctttccccatgtttagcaaggtcgcagtt
actggcactggtgcccaccctgccttcaagtacctgatccagacttctgggaaggagccc
acctggaacttctggaagtacctagtggccccagatggaaaggtagtaggggcttgggac
ccaactgtgtcggtggaggaaatcaggccccagatcacagcactcgtgaggaagctcatc
ctgaagaagcgagaagacttataa

KEGG   Panthera tigris altaica (Amur tiger): 102959037
Entry
102959037         CDS       T02988                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102959037 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102959037 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102959037 (GPX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102959037 (GPX1)
   05016 Huntington disease
    102959037 (GPX1)
   05022 Pathways of neurodegeneration - multiple diseases
    102959037 (GPX1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102959037 (GPX1)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 102959037
NCBI-ProteinID: XP_015395853
LinkDB
Position
Un
AA seq 147 aa
LTEELLVCGPNVSPPLAAPGSSCSSLTQENAKNEEILNSLKYVRPGGGFEPNFTLFEKCE
VNGAQAHPLFAFLRQALPAPSDDATALMTDPKFITWSPVCRNDVAWNFEKFLVGPDGVPV
RRYSRRFPTIDIEPDIEALLSQGPSCA
NT seq 444 nt   +upstreamnt  +downstreamnt
ctcaccgaggaacttctggtttgcggtccgaacgtttcccctcccctcgcggccccgggt
tctagctgctcttccctcacgcaggagaacgctaaaaacgaagagatcctgaattccctt
aagtacgtccgacctggcggcgggttcgagcccaacttcacgctttttgagaagtgcgag
gtaaatggcgcgcaggcgcaccccctcttcgccttcctgcgccaggctctgcctgccccc
agtgacgacgccactgcgctcatgactgacccgaagttcatcacctggtctccagtgtgt
cgcaacgacgtcgcctggaactttgagaagttcctggtgggcccagatggtgtgcctgtg
cgcaggtacagccgccgctttccaaccatcgacattgagcctgacatcgaagccctgctg
tcccaggggcccagctgtgcctag

KEGG   Panthera tigris altaica (Amur tiger): 102959727
Entry
102959727         CDS       T02988                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102959727 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102959727 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102959727 (GPX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102959727 (GPX3)
   05016 Huntington disease
    102959727 (GPX3)
   05022 Pathways of neurodegeneration - multiple diseases
    102959727 (GPX3)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102959727 (GPX3)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 102959727
NCBI-ProteinID: XP_007093471
LinkDB
Position
Un
AA seq 226 aa
MARLLRASCLLSLLLAGFVPPSRGQEKSKTDCHAGGSGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTGQYVELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPSLK
HVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPNRLFWEPMKVHDIR
WNFEKFLVGPDGVPLMRWYHRTTVSTVKMDILAYMRRQAALTVNGK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcccgcctgttgcgggcgtcctgtcttctctccctgctcctggctggcttcgtcccg
ccgagccgggggcaggagaagtccaagacggactgccacgctggcgggagcggcactatc
tatgagtacggagccctgaccatcgatggggaggagtacatcccttttaagcagtatgct
ggcaaatacatcctgtttgtcaacgtggccagctactgaggcctaacaggccagtacgtt
gaactgaatgcactacaggaagagcttgcaccatttgggctggtcattctgggcttcccc
tgcaaccaatttggaaaacaggaaccaggagagaactcggaaatcctacccagcctcaag
catgtccgaccaggtgggggcttcgtccccaatttccaactctttgagaaaggggatgtg
aacggggagaaagagcagaagttctacacgttcctgaagaactcctgcccacccacctcg
gagctcctgggctcacctaaccgcctcttctgggaacccatgaaggtccatgacatccgc
tggaactttgagaagttcctggtggggccagatggcgtgcccctcatgcgctggtaccac
cggaccacggtcagcaccgtcaagatggacatcctggcctacatgaggcggcaggcggcc
ctgacagtcaatgggaagtaa

KEGG   Panthera tigris altaica (Amur tiger): 102966993
Entry
102966993         CDS       T02988                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102966993 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102966993 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102966993 (GPX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102966993 (GPX2)
   05016 Huntington disease
    102966993 (GPX2)
   05022 Pathways of neurodegeneration - multiple diseases
    102966993 (GPX2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102966993 (GPX2)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 102966993
NCBI-ProteinID: XP_007095247
LinkDB
Position
Un
AA seq 190 aa
MAYIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSFMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcttacatagccaagtctttctacgacctcagcgctatcagcctggatggggagaag
gtagatttcaatacgttccgaggcagggcagtgctgattgagaatgtggcctcgctctga
ggcacaaccactcgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggttcttggcttcccttgcaatcaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtgcgccctgggggtggattccagcccacctttacc
cttgtccaaaagtgtgaggtgaatggtcagaacgagcatcccgtcttcgcctacctgaag
gacaagctcccctacccgtatgatgacccattttccttcatgaccgatcccaagttcatc
atttggagcccggtacgccgctcagatgtggcctggaactttgagaagttccttattggg
ccggaaggggagcccttccgccgctacagtcgcaccttccctaccatcaacattgagcct
gacatcaagcgcctcctcaaagttgccatatag

KEGG   Panthera tigris altaica (Amur tiger): 102967167
Entry
102967167         CDS       T02988                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102967167 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102967167 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102967167 (GPX6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102967167 (GPX6)
   05016 Huntington disease
    102967167 (GPX6)
   05022 Pathways of neurodegeneration - multiple diseases
    102967167 (GPX6)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102967167 (GPX6)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 102967167
NCBI-ProteinID: XP_007092780
LinkDB
Position
Un
AA seq 201 aa
MAQGQRPVLAFQMDCYTGVTGTIYEYGALTLSDGDYIQFKQYAGKVVLFVNVASYCGLTA
QYPELNALQDELKHYGVVVLGFPCNQFGKQEPGKNSEILSGLKYVRPGGGFVPSFQLFEK
GDVNGENEQKVFTFLKNSCPPTSDLLGSPDQLFWEPMKVHDIRWNFEKFLVGPNGVPVMR
WFHKAPISTVRLDILEYLKQL
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcacagggacagagaccagtgcttgcttttcagatggattgctatacgggggtgaca
ggcaccatctacgagtacggtgccctcacgctcagtgacggggactacatccagttcaag
cagtacgcgggcaaggtcgtcctcttcgtcaacgtggcctcctactgtggcttgacagct
cagtatcctgaactgaacgcacttcaggacgagctgaagcactatggcgtggtcgtgctg
ggctttccgtgcaaccagtttggaaaacaagaaccaggaaagaactcagagatcctttct
gggctcaagtatgtgcgtccaggtggcggcttcgtccccagctttcagctctttgagaaa
ggggatgtgaatggagaaaacgaacagaaggtctttaccttcctgaagaactcctgccct
ccgacctcggatcttttgggctcaccagaccagctgttctgggagcccatgaaggtccac
gacatccgctggaactttgagaagttcctggtggggcccaacggggtccctgtcatgcgc
tggttccacaaggctcccatcagcaccgtcagattggacatcctggagtacctgaagcag
ctataa

KEGG   Panthera tigris altaica (Amur tiger): 102967445
Entry
102967445         CDS       T02988                                 

Gene name
GPX5
Definition
(RefSeq) epididymal secretory glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102967445 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102967445 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102967445 (GPX5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102967445 (GPX5)
   05016 Huntington disease
    102967445 (GPX5)
   05022 Pathways of neurodegeneration - multiple diseases
    102967445 (GPX5)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102967445 (GPX5)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 102967445
NCBI-ProteinID: XP_007092781
LinkDB
Position
Un
AA seq 221 aa
MAQLPASSLFPLLLVGVTCMNPKPPEKVKMDCYKDVKGTIYEYDALTLNGKEHIQFKQYA
GKHVLFVNVATYCGLTAQYPELNALQDELKPWGLVVLGFPCNQFGNQEPGENSEILPGLK
YVRPGRGYVPNFQLFEKGDVNGKTEQKVFSFLKLSCPPTSDLLGSPDQLFWEPMKVHDIR
WNFEKFLVGPNGVPVMRWFHQAPISTVRADILEYLKQLKTK
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcacagttaccggcctcctccctcttccctcttctgctagtcggcgtcacgtgcatg
aatcccaagcccccagagaaggtgaagatggattgctacaaagatgtgaaaggcaccatc
tacgaatatgacgccctcactcttaatggaaaggaacacattcagttcaagcagtacgcg
ggcaagcacgtccttttcgtcaacgtggccacctactgcggtctgacggctcagtatcct
gaactgaacgcacttcaggacgagctgaagccctggggcctggtcgtgctgggctttccc
tgcaaccagtttgggaaccaggaaccaggagagaactcggagatccttccggggctgaag
tatgtgcgtccagggagaggatatgtaccgaatttccagctttttgagaaaggggatgtg
aatggcaaaacagaacagaaagtcttcagcttcttgaagctctcctgccctccgacctcg
gatcttttgggctcaccagaccagctgttctgggagcccatgaaggtccacgacatccgc
tggaactttgagaagttcctggtggggcccaacggggtccctgtcatgcgctggttccac
caggctcccatcagcaccgtcagagcggacatcctggagtacctgaagcagctaaaaacg
aaatag

KEGG   Panthera tigris altaica (Amur tiger): 102972733
Entry
102972733         CDS       T02988                                 

Gene name
GPX8
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102972733 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102972733 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102972733 (GPX8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102972733 (GPX8)
   05016 Huntington disease
    102972733 (GPX8)
   05022 Pathways of neurodegeneration - multiple diseases
    102972733 (GPX8)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102972733 (GPX8)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 102972733
NCBI-ProteinID: XP_007080006
LinkDB
Position
Un
AA seq 210 aa
MEPLTAYPLRCSGPKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKFKGKEVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPS
KEVVSFARNNYGVTFPIFHKIKILGSEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVK
TWRPEEPIEVIRPEIAALIRQMIIKKKEDL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggagcctcttacagcttaccctttaagatgttcggggccgaaagcaaaggtatttgca
gttttactgtctatggttctatgcacagtaatgttatttcttctacaactaaaattccta
aaacctaaaatcaacagcttttatgcctttgaagtgaaagatgcaaaaggaagaacggtt
tctctggaaaagtttaaaggcaaagaggttgcactagttgtaaacgtggctagtgactgc
caactcacagacagaaattacttagcactgcaggaactgcacaaagagtttggaccattc
cacttcagcgtcttggcttttccgtgcaatcagtttggagaatcggagccccgccccagc
aaggaagttgtatcttttgcaagaaataactacggcgtgacattccccatcttccacaag
attaagattctaggatctgaagcagaacctgcattcagatttcttgttgattcttcaaag
aaagaaccaaggtggaatttttggaagtatctggtcaaccctgagggtcaagttgtgaaa
acctggaggccagaggaacccattgaagtcatcaggcctgagatagcagctctgattaga
caaatgatcataaaaaagaaagaggacctatga

DBGET integrated database retrieval system