KEGG   Panthera tigris altaica (Amur tiger): 102953956Help
Entry
102953956         CDS       T02988                                 

Gene name
IL7R
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04068  FoxO signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04630  Jak-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg05200  Pathways in cancer
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102953956 (IL7R)
   04068 FoxO signaling pathway
    102953956 (IL7R)
   04151 PI3K-Akt signaling pathway
    102953956 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102953956 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102953956 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953956 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    102953956 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102953956 (IL7R)
   04090 CD molecules [BR:ptg04090]
    102953956 (IL7R)
Cytokine receptors [BR:ptg04050]
 Interleukin receptor families
  IL2 receptor family
   102953956 (IL7R)
CD molecules [BR:ptg04090]
 Proteins
  102953956 (IL7R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FN3_7 fn3
Motif
Other DBs
NCBI-GeneID: 102953956
NCBI-ProteinID: XP_007097476
LinkDB All DBs
Position
Un
AA seq 457 aa AA seqDB search
MMILGTAFGMVFYLLQVVSGESGYAQNGDFDDAELDDYPFSCYSQLEVDGSQHLLTCTFD
DPDVNSTNLEFEICGALLDVKCLTFNKMQEMYFIRTKKFLLIGDSEICVKLKGKKITCRK
MNVVKIVKPEAPFDIRVIYREGANDFLVTFNTSHLQKKYVKELLHEVAYRQEKHENDWMH
VNLSSTKLALLQRKLQPDAMYEIKVRSIPNHDYFEGFWSEWSPSFHFRTPEITGRMDPIL
LTISILSFFSVSLMVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPES
FLDCQIHKVDGIQARDEAEGFLQDTSLPQPEESEKQRLVGGVQSPTWPSEHAVITPKTFR
GDSPLGCLAGNVSMCEALVLPSSRPPDFRDGGKNGPHVYQGLLLVPGTTNGPGPTPFPFQ
SGILTLNPAAQGQPILTSLGSSQEEAYVTMSSFYQNQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatgattctaggtacagcttttggtatggttttctatttacttcaagtcgtttctgga
gaaagtggctatgcacagaatggagactttgatgatgccgaactggatgactatccattc
tcgtgttacagtcagttggaagtggatggatcccagcacttgctgacctgtacttttgac
gacccagatgtcaatagcaccaatctggaatttgaaatatgtggggctcttttggatgtg
aaatgcctgacttttaataaaatgcaagagatgtatttcatcaggacaaagaaattctta
ctgattggagacagtgaaatatgtgtgaagcttaaaggaaaaaagataacttgcaggaaa
atgaacgtagtcaagatagttaaacctgaggctccttttgacataagagtcatctatcgt
gagggagcaaatgactttctggtgacatttaacacatctcacttacaaaagaagtatgtg
aaagaattattgcatgaggtagcctatcgccaggaaaaacatgaaaatgactggatgcat
gtgaacttatccagtacaaagctggcactcctacagagaaagctacaacctgatgcaatg
tatgagattaaagtccggtccattcctaatcatgactattttgaaggcttctggagtgaa
tggagtccaagcttccacttcagaactccagagatcacagggaggatggatcctatttta
ctaactattagcattctgagtttcttctctgtgtctctgatggtcatcttggcctgtgca
ttatggaaaaaaagaattaaacctattgtgtggcccagtctcccggatcataagaagact
ctggaacaactttgcaagaaaccaaaaaagaatttgaatgtgagtttcaatcctgaaagt
ttcctggactgccagattcataaggtggatggcattcaagctagagatgaagccgaaggc
tttctgcaagacacttctctgccacaaccagaggagtctgaaaagcagaggcttgtaggg
ggtgtgcagagccccacctggccatctgagcatgcagtcatcaccccaaaaacgttcaga
ggagattcacccctcggatgcctggctgggaatgtcagtatgtgtgaggcccttgtgctc
ccatcttccagacccccagacttcagggatggtggcaagaatgggcctcatgtgtaccag
ggcctgctgcttgtccctggaactacaaatggccctgggcccactccatttcctttccaa
tcaggaatcctgacattgaacccagctgcccagggacaacccattctcacttccttggga
tcgagccaggaagaagcctatgtcaccatgtccagtttctaccaaaaccagtga

DBGET integrated database retrieval system