KEGG   Panthera tigris altaica (Amur tiger): 102954094
Entry
102954094         CDS       T02988                                 

Gene name
GMPS
Definition
(RefSeq) guanine monophosphate synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Module
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102954094 (GMPS)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102954094 (GMPS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102954094 (GMPS)
Enzymes [BR:ptg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     102954094 (GMPS)
Peptidases and inhibitors [BR:ptg01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   102954094 (GMPS)
SSDB
Motif
Pfam: GATase GMP_synt_C NAD_synthase Peptidase_C26 QueC tRNA_Me_trans ATP_bind_3 Asn_synthase PAPS_reduct ThiI Arginosuc_synth DUF4135
Other DBs
NCBI-GeneID: 102954094
NCBI-ProteinID: XP_007086338
LinkDB
Position
Un
AA seq 699 aa
MALESSSIHFSTQKRLENAGGDLKDGCHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEI
FPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVF
GGTVHKKSVREDGVFSISVDNTCSLFRGLQKEEIVLLTHGDSVDKVADGFKVVARSGNIV
AGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERV
GTSKVLVLLSGGVDSTVCTALLNRALNQDQVIAVHIDNGFMRKRESQSVEEALKKLGIQV
KVINAAHSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGE
MNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEVKVIEPLKDF
HKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSA
SVKKPHTLLQRVKACTSEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISS
KDEPDWESLIFLARLIPRMCHNINRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFE
AHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPG
NEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggctttagaaagttcaagtatccatttttcaactcaaaaaaggctggagaatgctgga
ggagaccttaaggatggctgccaccactatgaaggagctgttgtcattctggatgctggt
gcccagtatgggaaagtcatagaccgaagagtacgagaactgttcgtgcagtcggaaatc
ttccccttggaaacaccagcatttgctataaaagagcaaggattccgtgctattatcatc
tctggaggccctaattctgtgtatgcagaagatgctccctggtttgatccagcaatattc
acgattggcaagcctgttcttggaatttgctatggcatgcagatgatgaataaggtattt
ggaggtactgtgcacaaaaaaagtgttagagaagatggagtcttcagtattagtgtggac
aacacatgctcattgttcaggggccttcagaaggaagaaattgttttgcttacccacgga
gatagtgtagacaaagtagctgatggattcaaggttgtggcacgttctgggaacattgtg
gcaggtatagcaaatgaatctaaaaaattatacggagcacagttccaccctgaagttggt
cttacagaaaatgggaaagtaatactgaagaatttcctctatgatatagctgggtgcagt
gggaccttcactgtgcagaacagagaacttgagtgcattcgagagatcaaagagagagta
ggcacatcaaaagttttggttttactcagtggtggagttgactcaacagtttgtacagct
ttgctgaatcgtgctttgaaccaagatcaagtcattgccgtgcacattgataatggcttt
atgagaaaacgagaaagccagtctgtagaagaggccctcaaaaagcttggaattcaggtc
aaagtgataaatgctgctcattccttctacaatggaacaacaactctaccaatatcagat
gaagatagaactccacgaaaaagaattagcaaaacgttaaatatgactacaagtcctgaa
gagaaaagaaaaattattggagatacttttgttaagattgccaatgaagtgattggagaa
atgaacctgaaaccagaggaggttttcctcgcccaaggtactttacggcctgatttaatt
gaaagtgcttcccttgttgcaagtggcaaagctgaactcatcaaaacccatcacaatgac
acagagcttatcagaaagttgagagaagaggtaaaagtaatagaacctctgaaagatttt
cataaagatgaagtaagaattttaggcagagaacttggacttccagaagagttagtttcc
aggcatccatttccaggtcctggcttggcaatcagagtaatatgtgctgaagaaccttat
atttgtaaggactttcctgaaaccaacaatattttgaaaatagtagctgatttttctgca
agtgttaagaagccacatacactgttacaaagagtcaaagcttgtacatcagaagaggat
caggagaagctgatgcaaattacaagtttgcattcattgaatgccttcctgctgccaatt
aaaactgtaggtgtgcagggtgactgtcgttcctacagttacgtgtgtggaatctccagt
aaagatgagcctgactgggaatctcttattttcctggctagacttatacctcgcatgtgt
cacaacattaacagagttgtctatatatttggcccaccagttaaagaacctcctacagat
gttactcccactttcttgacaacaggggtgctcagtactttacgccaagctgactttgag
gcacataacattctcagggagtctgggtatgctgggaaaattagccagatgccagtgatt
ttgacaccattacattttgatcgagacccgcttcagaagcagccttcatgtcagagatct
gtggttattcgaacctttattactagtgattttatgactggtatacctgcaacgcctggc
aatgaaatccctgtagaggtggtgttaaagatggtcactgagattaagaagattcctggt
atttctcgaattatgtatgacttaacatcaaagcccccaggaactaccgagtgggagtaa

DBGET integrated database retrieval system