KEGG   Panthera tigris altaica (Amur tiger): 102954103Help
Entry
102954103         CDS       T02988                                 

Gene name
CD4
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04514  Cell adhesion molecules (CAMs)
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg05166  Human T-cell leukemia virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102954103 (CD4)
   04514 Cell adhesion molecules (CAMs)
    102954103 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102954103 (CD4)
   04612 Antigen processing and presentation
    102954103 (CD4)
   04660 T cell receptor signaling pathway
    102954103 (CD4)
   04658 Th1 and Th2 cell differentiation
    102954103 (CD4)
   04659 Th17 cell differentiation
    102954103 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102954103 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    102954103 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102954103 (CD4)
   05170 Human immunodeficiency virus 1 infection
    102954103 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102954103 (CD4)
CD molecules [BR:ptg04090]
 Proteins
  102954103 (CD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD4-extracel C2-set ig Tcell_CD4_C Ig_3 V-set Ig_2 I-set Ig_5 Herpes_gE Ig_6 Receptor_2B4
Motif
Other DBs
NCBI-GeneID: 102954103
NCBI-ProteinID: XP_007089661
LinkDB All DBs
Position
Un
AA seq 469 aa AA seqDB search
MNQGAAFRHLLLVLQLVMLEAAVTQGKEVVLGKAGGTAELPCQASQKKYMTFTWRLSSQV
KILESQHPSLCLTGSSKLKTRFECKKILWDQGSFLLVIKSLQIADSGIYTCEVEDKKKEV
ELLVFSLTAKVDPSGSSSSSSSTSIHLLQGQSLTLTLESPSGSNPSVQWKGPGNKSKSGV
HSLSLSQLELQESGTCTCTVSQSQKTLVFNTNILVLAFQKVSNTVYAKEGEQVEFSFPLN
FEDENLTGKLRWKAEGAPSSLLWISFTLKNKKISVKEVDQYSKLQMKDSLPLHFTLPNVL
SRYAGSGNLTLVLDKGQLQQEVKLVVMRVTQSGNNLTCEVLGPTSPELTLSLKLEEQAAK
VSKQQKMVRVEDAEVGTWQCLLSHKDKVLLASKAEVLPPVLTRTWTNLLTIVLGGVLGLV
LFTGLWAYCCVKCWHRRRQAARMSQIKRLLSEKKTCQCSHRLQKTCNPI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaggagctgcttttaggcacctgctcctggtgctgcagttggtgatgctcgaa
gcagctgtcactcagggaaaggaagtggtgctggggaaggcaggaggcacggcagagctg
ccctgccaagcatcccagaagaagtacatgacctttacctggagactttcttcccaggtc
aagattctggaaagtcagcacccctccttatgccttacaggctcctccaagctgaaaact
cgctttgaatgcaaaaaaatcctgtgggaccaaggatcctttcttctggtcatcaagagc
cttcaaatcgcagactcagggatttacacctgtgaagtggaggacaagaaaaaagaggtg
gaactgctggtgttcagcttgactgccaaggtggaccccagcggcagcagcagcagcagc
agcagcaccagcatccacctgctgcaagggcagagcctgaccctgaccttggagagcccc
tccggtagtaacccttcggtgcaatggaaaggtccagggaataaaagcaagagtggggtc
cacagcctctcactgtcccagctggagttgcaggagagtggcacctgcacatgcactgtc
tcccagagccagaagacattggtgttcaacacaaacatcttggtgctggctttccagaag
gtctctaacacggtctatgcgaaagaaggggagcaggtggagttttccttcccgctcaac
ttcgaagatgaaaacctgacggggaagctgaggtggaaggcagagggggctccctcctcc
ctgctctggatctccttcaccttgaagaacaagaagatatctgtgaaagaggttgaccag
tactccaaactccagatgaaggactcactcccgctccactttaccctgcccaacgttttg
tctcgttatgccggttctggaaacctgaccctggtccttgacaagggacagttgcagcag
gaagtaaaactcgtggtgatgagagtgactcagtctgggaacaatttgacctgtgaggtg
ctgggacccacctcccctgagctgacgctgagcttgaaactcgaagagcaggctgccaag
gtctcaaagcagcagaagatggtaagggtggaggacgccgaggtgggaacatggcaatgt
ctactgagtcacaaggacaaagtcttgctggcatccaaggccgaggttttgcctcctgtg
ctcaccaggacctggacaaatctcttgaccatcgtgctgggcggggtcctaggccttgtg
cttttcactgggctctgggcctactgctgtgttaagtgctggcaccgcaggcgccaggca
gctcggatgtctcagatcaagagactcctcagtgagaagaaaacctgccaatgctcccac
cggttacagaagacatgtaatcccatttga

DBGET integrated database retrieval system