KEGG   Panthera tigris altaica (Amur tiger): 102954275
Entry
102954275         CDS       T02988                                 

Gene name
MSH2
Definition
(RefSeq) mutS homolog 2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03430  Mismatch repair
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102954275 (MSH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102954275 (MSH2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102954275 (MSH2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102954275 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102954275 (MSH2)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     102954275 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV AAA_27
Other DBs
NCBI-GeneID: 102954275
NCBI-ProteinID: XP_007084767
LinkDB
Position
Un
AA seq 934 aa
MAVLPKETLQLESAAEIGFVRFFQTMPEKPTTTVRLFDRGDFYTAHHEDALLAAREVFKT
QGVVKYIGPPGTKTLESVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
FKASPGNLSQFEDILFGNNDMSASIGVVGVKISTVDGQRQVGVGYVDSIQRKLGLCEFPD
NDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQVIQRGGILITERKRGDFFTKDIYQD
LNRLLKGKKGEQMNSAVLPEMENQVAASSLSAVIKFLELLSDDSNFGQFELTTFDFSQYM
RLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERL
NLVEAFVEDAELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIRA
LEKYEGKHQRLLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSE
LREIMDDLEKKMQSTLVSAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFS
TVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLA
QLDAVVSFAHVSNGAPVPYVRPVILEKGQGRITLKASRHACVEVQDEVAFIPNDVHFEKD
KQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLK
GVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMF
ATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHV
IECAKQKALELEEFQNIGKSQNYGEMEPAAKRCYLEREQGEKIIQEFLSKVKQVPFTEMS
EENITKKLKQLKAEVIAKNNSFVNEIISRIKVTT
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggcggtgctgccgaaggagacgctgcagctggagagcgcggccgagatcggcttcgtg
cgcttcttccagaccatgccggagaagccgaccaccacggtgcgcctcttcgaccggggc
gacttctacacggcgcaccacgaggacgcgctgctggccgcccgagaagtgttcaagacc
cagggggtggtcaagtacatagggccgccaggaacaaagactctggagagtgttgtgctt
agtaaaatgaattttgagtcttttgtaaaagatcttcttctagttcgtcagtatagagtt
gaagtttataagaatagagctggaaataaggcctcgaaggagaatgattggtatttggca
tttaaggcttctccaggtaatctttctcagtttgaagacattctctttggtaacaacgat
atgtcagcttccattggtgttgtgggtgttaaaatatctacagttgatggccaaagacag
gtcggtgttgggtatgttgactccatacagaggaagctaggactttgtgagttccctgat
aacgatcagttctccaatctggaggctcttctaattcagattggaccaaaggaatgtgtt
ttaccaggaggagagactgctggagacatgggaaagctgagacaggttattcagagagga
ggaattctgatcacagaaagaaaaagaggtgacttttttacaaaagatatttatcaggac
ctcaaccggttgttgaaaggcaaaaagggagagcagatgaatagtgctgtcttgccagaa
atggagaatcaggttgcagcttcatcattgtctgcagtaatcaagtttttagaactctta
tcagatgattcaaactttggacagtttgaactgactacttttgacttcagtcagtacatg
aggttggatattgcagcagtcagagcccttaaccttttccagggttctgttgaagatacc
actggctctcagtctctggctgcattgctaaataaatgcaaaacccctcaaggacaaaga
ctggttaaccagtggattaagcagcctctcatggataagaacagaatagaagagagacta
aatttagtggaagcttttgtagaagatgcagaattgaggcagagtttacaagaggattta
cttcgtcgatttccagatcttaaccgacttgccaagaaatttcaaagacaggcagcaaac
ttacaagattgttaccgactctatcagggtataaatcaactccctaatgttattcgggct
ctggaaaaatatgaaggaaaacaccagagattactcttggcagtttttgtgactcctctt
attgatcttcgttctgatttctccaagtttcaggaaatgatagaaacaacattagatatg
gatcaggtggaaaaccatgaattccttgtaaaaccttcatttgatcctaatctgagtgaa
ttaagagaaataatggatgacttggaaaagaagatgcagtcaacattagtaagtgcagca
agagatctaggcttggatcctggcaaacagattaagctggattccagtgcacagtttggt
tattacttccgtgtaacgtgtaaggaagaaaaagtccttcgtaacaataaaaacttcagt
acagtagatatccagaagaatggtgttaaatttaccaacagtaaactgacttctctcaat
gaagagtataccaaaaataaaactgagtatgaggaagcccaggatgcaattgttaaagaa
attgtcaatatttcttcaggttatgtagaaccaatgcagacactcaatgatgtattagct
cagctagatgctgttgtcagctttgcacatgtgtcaaatggagcacctgttccatatgta
cgaccggtcattctggagaaaggacaaggaagaattacgttgaaagcatccagacatgct
tgtgttgaagttcaagatgaagttgcatttattcctaatgatgttcactttgaaaaagat
aaacagatgttccacatcattactggccctaatatgggaggtaaatcaacatatattcgc
caaactggggtgatagttctcatggcccagattgggtgttttgtgccatgtgagtcagca
gaagtgtccattgtggactgcatcttagcccgagtaggggctggcgacagtcagttgaaa
ggagtctccacattcatggctgaaatgctagaaactgcttctattctcaggtctgcaacc
aaagattctttaataatcatagatgaactgggaagaggaacctctacttacgatggattt
ggattagcctgggctatatcagagtacattgcaacaaagattggtgctttttgcatgttt
gcaacacattttcatgaacttactgccttggccaatcagataccaactgttaataaccta
catgtcacagcactaactaccgaagagaccttaactatgctgtatcaggtgaagaaaggt
gtctgtgaccaaagtttcgggattcatgttgcagagcttgcaaatttccctaggcatgta
atagagtgtgctaaacaaaaagccctggaactagaggagtttcagaatattggaaaatca
caaaactatggtgaaatggaaccagcagcaaagaggtgctatctggaaagagagcaaggt
gaaaaaattattcaagaatttttatccaaggtgaagcaagtgccttttactgaaatgtcg
gaagaaaacatcacaaaaaagttaaaacagctgaaagctgaggtaatagcaaagaataat
agttttgtaaatgaaatcatttcacgaatcaaagttactacatga

DBGET integrated database retrieval system