KEGG   Panthera tigris altaica (Amur tiger): 102954326
Entry
102954326         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102954326
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102954326
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102954326
   04612 Antigen processing and presentation
    102954326
   04658 Th1 and Th2 cell differentiation
    102954326
   04659 Th17 cell differentiation
    102954326
   04672 Intestinal immune network for IgA production
    102954326
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102954326
   05322 Systemic lupus erythematosus
    102954326
   05323 Rheumatoid arthritis
    102954326
   05320 Autoimmune thyroid disease
    102954326
   05321 Inflammatory bowel disease
    102954326
   05330 Allograft rejection
    102954326
   05332 Graft-versus-host disease
    102954326
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102954326
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102954326
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102954326
   05152 Tuberculosis
    102954326
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102954326
   05164 Influenza A
    102954326
   05168 Herpes simplex virus 1 infection
    102954326
   05169 Epstein-Barr virus infection
    102954326
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102954326
   05140 Leishmaniasis
    102954326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102954326
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102954326
  Exosomal proteins of epithelial cells
   102954326
  Exosomal proteins of breast milk
   102954326
SSDB
Motif
Pfam: C1-set MHC_II_beta ig Ig_3 Ig_2 C2-set_2 Bac_rhamnosid_C
Other DBs
NCBI-GeneID: 102954326
NCBI-ProteinID: XP_007093298
LinkDB
Position
Un
AA seq 285 aa
MSLSCSRQPTCSETPETVRPSNEMMKVEGGSRMVVLRVPGAPGMAALMMSLMTLSSPLVQ
SRDTPELYLYQRRSVCYELNRTHRFLEQYVYNRELFIQFDSDSTAGVFVAESELGRETAK
NWNIQKEFLELRRSAVDMVCKHNFEPDEGFTLQRRVQPNVNVSPSKKGHLQHHNLLVCHV
SDFYPGHIQVRWFLNGQEETAGVLSTNPIHNGDWTFQMLVMLEMTPQQGDVYTCQVEHPS
LDGPVTVEWKAQSDSAQSKMLAGVGGFVLGFVALGVSLLLRFRSR
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtcactctcctgctctcgtcagcccacgtgctctgaaactcctgagacagtgaggccc
agcaacgagatgatgaaagttgaaggaggctccaggatggtggtcctgagggtccctggg
gccccggggatggcagctctcatgatgtccttgatgacgctgagctcccctttggttcag
agcagagacaccccagagctttacctctaccagaggcggagtgtctgctacgagttgaac
aggacacaccgcttcctggaacaatacgtgtacaacagagagctgttcatccagttcgac
agtgacagcaccgcgggggtgtttgtggcggagtctgagctgggccgagaaactgccaag
aactggaacatccagaaggagttcctggagctgagacggagcgccgtggacatggtgtgc
aagcacaactttgagccggacgagggtttcacgctgcagcgcagagtccagcctaacgtg
aacgtctccccctccaagaaggggcacctgcagcaccacaacctgcttgtttgccatgtg
tcagatttctatcccggccacattcaagtccgctggttcctgaatggacaggaggaaaca
gctggggttttatccactaacccgatccataatggagactggaccttccagatgctggtg
atgctggaaatgaccccccagcagggagatgtctacacctgccaggtggagcaccccagc
ctggacggtcctgtcaccgtggagtggaaggcacagtctgattctgcccagagcaagatg
ctggctggagtcggaggcttcgtgctagggttcgtggctctcggagtgagcctccttctc
cgttttagaagccgttga

KEGG   Panthera tigris altaica (Amur tiger): 102954602
Entry
102954602         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102954602
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102954602
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102954602
   04612 Antigen processing and presentation
    102954602
   04658 Th1 and Th2 cell differentiation
    102954602
   04659 Th17 cell differentiation
    102954602
   04672 Intestinal immune network for IgA production
    102954602
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102954602
   05322 Systemic lupus erythematosus
    102954602
   05323 Rheumatoid arthritis
    102954602
   05320 Autoimmune thyroid disease
    102954602
   05321 Inflammatory bowel disease
    102954602
   05330 Allograft rejection
    102954602
   05332 Graft-versus-host disease
    102954602
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102954602
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102954602
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102954602
   05152 Tuberculosis
    102954602
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102954602
   05164 Influenza A
    102954602
   05168 Herpes simplex virus 1 infection
    102954602
   05169 Epstein-Barr virus infection
    102954602
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102954602
   05140 Leishmaniasis
    102954602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102954602
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102954602
  Exosomal proteins of epithelial cells
   102954602
  Exosomal proteins of breast milk
   102954602
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 102954602
NCBI-ProteinID: XP_007093299
LinkDB
Position
Un
AA seq 250 aa
MVLSGGLVLGLHTLMSLLSPHKAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK
FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHLFRKFYYLTFV
PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTTETLVCALGLALGLVGFLVGTTLII
RGTCLSSAPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctcagtggggggctagtcctgggactccacaccttgatgagcctcctgagcccc
cacaaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcaccagagccaccaacgtgcctccgagggtgactgtattccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag
accagcttctattcccagcctgaccatctgttccgcaagttctactacctgaccttcgtg
ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc
ttcaggcactgggagccccagatgcctatcccgctgccagacaccactgagactctggtc
tgtgccctcggcctggccctcggcctggtgggctttcttgtgggcaccactctcatcatc
agaggcacatgcttgtccagtgcccccaggtaa

KEGG   Panthera tigris altaica (Amur tiger): 102956041
Entry
102956041         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102956041
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102956041
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102956041
   04612 Antigen processing and presentation
    102956041
   04658 Th1 and Th2 cell differentiation
    102956041
   04659 Th17 cell differentiation
    102956041
   04672 Intestinal immune network for IgA production
    102956041
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102956041
   05322 Systemic lupus erythematosus
    102956041
   05323 Rheumatoid arthritis
    102956041
   05320 Autoimmune thyroid disease
    102956041
   05321 Inflammatory bowel disease
    102956041
   05330 Allograft rejection
    102956041
   05332 Graft-versus-host disease
    102956041
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102956041
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102956041
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102956041
   05152 Tuberculosis
    102956041
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102956041
   05164 Influenza A
    102956041
   05168 Herpes simplex virus 1 infection
    102956041
   05169 Epstein-Barr virus infection
    102956041
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102956041
   05140 Leishmaniasis
    102956041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102956041
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102956041
  Exosomal proteins of epithelial cells
   102956041
  Exosomal proteins of breast milk
   102956041
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 102956041
NCBI-ProteinID: XP_007093305
LinkDB
Position
Un
AA seq 261 aa
MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAILFDKAFCQAMIREIGPKLEGKI
PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD
GLSFQAFSYLNFTPVPSDLYSCMVTHEIDSYTAIAFWVPHNALPSDLLENVLCGVAFGLG
VLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg
ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa
aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct
gaaacttatgatggagaccagcttttctccttcgacttttcccagaatacccgagtgcct
cgcctacctgaatttgctgactgggctcagaagcttggagatacttctgccattttattt
gacaaagcattctgccaggctatgatccgggaaatagggccaaaacttgaagggaaaatc
cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac
tggcagcatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat
ggactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac
tcctgcatggtaactcatgagattgacagctacaccgcaattgccttttgggtgccccat
aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt
gtgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt
gattga

KEGG   Panthera tigris altaica (Amur tiger): 102956510
Entry
102956510         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102956510
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102956510
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102956510
   04612 Antigen processing and presentation
    102956510
   04658 Th1 and Th2 cell differentiation
    102956510
   04659 Th17 cell differentiation
    102956510
   04672 Intestinal immune network for IgA production
    102956510
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102956510
   05322 Systemic lupus erythematosus
    102956510
   05323 Rheumatoid arthritis
    102956510
   05320 Autoimmune thyroid disease
    102956510
   05321 Inflammatory bowel disease
    102956510
   05330 Allograft rejection
    102956510
   05332 Graft-versus-host disease
    102956510
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102956510
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102956510
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102956510
   05152 Tuberculosis
    102956510
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102956510
   05164 Influenza A
    102956510
   05168 Herpes simplex virus 1 infection
    102956510
   05169 Epstein-Barr virus infection
    102956510
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102956510
   05140 Leishmaniasis
    102956510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102956510
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102956510
  Exosomal proteins of epithelial cells
   102956510
  Exosomal proteins of breast milk
   102956510
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set SPARK
Other DBs
NCBI-GeneID: 102956510
NCBI-ProteinID: XP_007093308
LinkDB
Position
Un
AA seq 263 aa
MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSK
MVPCEFGVLSVLANYFSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL
ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIILSLGLLSW
RKASSSGYIFLPGSIYPEGQHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaacacactcctgccattgctgctaggcctcagcctgggctccaccagagcaggtggc
tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacctgctgggatccccaaacatccaaa
atggtcccttgtgaatttggggtactgagtgtcttggcaaattacttctcagattacctc
aatcaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacat
acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga
agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta
gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt
gagcccatctgcgaggactggacacctgggctgtccccgatgcagacactgaaggtttcg
gtggctgcagtgactctgggcctgggcctcatcattttgtctcttggtttgctcagctgg
cggaaagctagctcctctggctacattttcctccctgggtccatttatccagaaggtcaa
cacatctcctag

KEGG   Panthera tigris altaica (Amur tiger): 102958869
Entry
102958869         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain-like
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102958869
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102958869
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102958869
   04612 Antigen processing and presentation
    102958869
   04658 Th1 and Th2 cell differentiation
    102958869
   04659 Th17 cell differentiation
    102958869
   04672 Intestinal immune network for IgA production
    102958869
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102958869
   05322 Systemic lupus erythematosus
    102958869
   05323 Rheumatoid arthritis
    102958869
   05320 Autoimmune thyroid disease
    102958869
   05321 Inflammatory bowel disease
    102958869
   05330 Allograft rejection
    102958869
   05332 Graft-versus-host disease
    102958869
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102958869
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102958869
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102958869
   05152 Tuberculosis
    102958869
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102958869
   05164 Influenza A
    102958869
   05168 Herpes simplex virus 1 infection
    102958869
   05169 Epstein-Barr virus infection
    102958869
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102958869
   05140 Leishmaniasis
    102958869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102958869
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102958869
  Exosomal proteins of epithelial cells
   102958869
  Exosomal proteins of breast milk
   102958869
SSDB
Motif
Pfam: MHC_II_beta C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 102958869
NCBI-ProteinID: XP_007093316
LinkDB
Position
Un
AA seq 299 aa
MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE
KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN
YKLGAPFTVGRKVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQERVGV
MSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRKMLSG
IAAFLLGLIFLLVGTVICLRAQKGYVETQLSGDEVMSSSLSLGGQLLSLCFGQRERSWG
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg
atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac
tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag
aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc
gacgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac
aatcggccagatatattggagaggagtaaagcttctgtggatgcactctgcagacataac
tacaagctgggtgcacccttcactgtggggagaaaagtgcaaccagaggtggcagtgtat
ccagagaggaccccatccctgcaacaccacaatctgctgctttgctctgtgacaggtttc
tatccaggggacatcaagatcatgtggttccggaatgggcagcaggagagagtaggggtc
atgtccactggccttatcaggaatggagactggacctttcagacaatggtgatgctggaa
atgactcctgaacttggagatgtctacacctgccttgttaatcatcccagcctgctgagc
cctatttctgtggagtggagagctcagtctgcatattcttggagaaagatgctaagtgga
attgcagccttcctgcttgggctgatcttccttctggtggggactgtcatctgcctcagg
gctcagaaagggtatgtggagacgcagttgtctggtgatgaggtaatgtcttcttccttg
tctttgggtggccaattgttgtccctgtgctttggccagagggagaggtcttggggatag

KEGG   Panthera tigris altaica (Amur tiger): 102959725
Entry
102959725         CDS       T02988                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102959725
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102959725
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102959725
   04612 Antigen processing and presentation
    102959725
   04658 Th1 and Th2 cell differentiation
    102959725
   04659 Th17 cell differentiation
    102959725
   04672 Intestinal immune network for IgA production
    102959725
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102959725
   05322 Systemic lupus erythematosus
    102959725
   05323 Rheumatoid arthritis
    102959725
   05320 Autoimmune thyroid disease
    102959725
   05321 Inflammatory bowel disease
    102959725
   05330 Allograft rejection
    102959725
   05332 Graft-versus-host disease
    102959725
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102959725
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102959725
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102959725
   05152 Tuberculosis
    102959725
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102959725
   05164 Influenza A
    102959725
   05168 Herpes simplex virus 1 infection
    102959725
   05169 Epstein-Barr virus infection
    102959725
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102959725
   05140 Leishmaniasis
    102959725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102959725
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102959725
  Exosomal proteins of epithelial cells
   102959725
  Exosomal proteins of breast milk
   102959725
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2
Other DBs
NCBI-GeneID: 102959725
NCBI-ProteinID: XP_007093321
LinkDB
Position
Un
AA seq 266 aa
MACLWFPRSFLMAALMVMLMVLSPPLAWARDTPPHFLNMWKAECHFTNGTERVRYLRRHF
YNGEEYVRFDSEVGEFRAVTELGRPTAKYWNGQKDFLEGRRTAVDWYCRHNYGVGESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPLTVEWRVQSESAQSKMLSGIGGFVLGLL
FLALGLFIYFRNQKGHSGLPPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcatgcctgtggttccctagaagtttcctgatggcagctctgatggtaatgctgatg
gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaatatgtgg
aaggccgagtgccatttcaccaacgggacggagcgggtgcggtacctgcggagacacttc
tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgacg
gagctggggcggcccactgccaaatactggaacgggcagaaggacttcctggaggggagg
cggacagcggtggactggtactgcagacacaactacggtgttggtgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctctcaccgtggaatggagggtacag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca
ccaacaggactcctgagctga

KEGG   Panthera tigris altaica (Amur tiger): 102960386
Entry
102960386         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102960386
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102960386
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102960386
   04612 Antigen processing and presentation
    102960386
   04658 Th1 and Th2 cell differentiation
    102960386
   04659 Th17 cell differentiation
    102960386
   04672 Intestinal immune network for IgA production
    102960386
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102960386
   05322 Systemic lupus erythematosus
    102960386
   05323 Rheumatoid arthritis
    102960386
   05320 Autoimmune thyroid disease
    102960386
   05321 Inflammatory bowel disease
    102960386
   05330 Allograft rejection
    102960386
   05332 Graft-versus-host disease
    102960386
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102960386
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102960386
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102960386
   05152 Tuberculosis
    102960386
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102960386
   05164 Influenza A
    102960386
   05168 Herpes simplex virus 1 infection
    102960386
   05169 Epstein-Barr virus infection
    102960386
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960386
   05140 Leishmaniasis
    102960386
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102960386
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102960386
  Exosomal proteins of epithelial cells
   102960386
  Exosomal proteins of breast milk
   102960386
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 102960386
NCBI-ProteinID: XP_007093322
LinkDB
Position
Un
AA seq 254 aa
MAVSRAPVLGFFIMALLMGPQESLAIKEEHVIIQAEFYMKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SVEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggctgtaagtagagccccagtgctaggatttttcatcatggctttactgatgggtcct
caagaatcattggctatcaaagaagagcatgtgatcatccaggctgagttctatatgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgcattggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcccgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggtggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggccttgtcgtgggtctggtgggaatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgcagagggcctctgtga

KEGG   Panthera tigris altaica (Amur tiger): 102961248
Entry
102961248         CDS       T02988                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102961248
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102961248
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102961248
   04612 Antigen processing and presentation
    102961248
   04658 Th1 and Th2 cell differentiation
    102961248
   04659 Th17 cell differentiation
    102961248
   04672 Intestinal immune network for IgA production
    102961248
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102961248
   05322 Systemic lupus erythematosus
    102961248
   05323 Rheumatoid arthritis
    102961248
   05320 Autoimmune thyroid disease
    102961248
   05321 Inflammatory bowel disease
    102961248
   05330 Allograft rejection
    102961248
   05332 Graft-versus-host disease
    102961248
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102961248
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102961248
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102961248
   05152 Tuberculosis
    102961248
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102961248
   05164 Influenza A
    102961248
   05168 Herpes simplex virus 1 infection
    102961248
   05169 Epstein-Barr virus infection
    102961248
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102961248
   05140 Leishmaniasis
    102961248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102961248
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102961248
  Exosomal proteins of epithelial cells
   102961248
  Exosomal proteins of breast milk
   102961248
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2
Other DBs
NCBI-GeneID: 102961248
NCBI-ProteinID: XP_007093326
LinkDB
Position
Un
AA seq 266 aa
MVCLCFLGGSWMTALMLILMVLSPPLAWARDTPPHFLLLGKTECHFTNGTELVRFLDRYF
YNGEEYVRFDSDVGEYRAVTELGRPDAKYWNGLKDYMEQARTAVDWYCRHNYGVGESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcctgggaggctcctggatgacagctctgatgttgatattgatg
gtgctgagccctcccctggcttgggccagggacaccccaccacatttcttgttgctgggg
aagaccgagtgccatttcaccaacgggacggagctggtgcgattcctggacagatacttc
tataacggggaggagtatgtgcgcttcgacagcgatgtaggggagtaccgggcggtgacg
gagctggggcggcctgacgccaagtactggaatgggctgaaggactacatggagcaggcg
cggacagcggtggactggtactgcagacacaactacggtgttggtgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Panthera tigris altaica (Amur tiger): 102966493
Entry
102966493         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102966493
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102966493
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102966493
   04612 Antigen processing and presentation
    102966493
   04658 Th1 and Th2 cell differentiation
    102966493
   04659 Th17 cell differentiation
    102966493
   04672 Intestinal immune network for IgA production
    102966493
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102966493
   05322 Systemic lupus erythematosus
    102966493
   05323 Rheumatoid arthritis
    102966493
   05320 Autoimmune thyroid disease
    102966493
   05321 Inflammatory bowel disease
    102966493
   05330 Allograft rejection
    102966493
   05332 Graft-versus-host disease
    102966493
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102966493
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102966493
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102966493
   05152 Tuberculosis
    102966493
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102966493
   05164 Influenza A
    102966493
   05168 Herpes simplex virus 1 infection
    102966493
   05169 Epstein-Barr virus infection
    102966493
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102966493
   05140 Leishmaniasis
    102966493
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102966493
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102966493
  Exosomal proteins of epithelial cells
   102966493
  Exosomal proteins of breast milk
   102966493
SSDB
Motif
Pfam: C1-set MHC_II_alpha Ig_3 Marek_A
Other DBs
NCBI-GeneID: 102966493
NCBI-ProteinID: XP_015397998
LinkDB
Position
Un
AA seq 204 aa
MFEFDEDEFYVDLDKKETIWHLPEFIHVFNFDAWRGIADIVTAKKNLNTLIQRSNHTRAT
NEPPEVAVFPKEPVELGQPNTLICHVDKFFPPVLNVTWLCNGQTVTKGVAESIFLPSTEF
RFHKFHYLTFIPTAEDVYDCKVEHWGLDQPLLQHWEAQEPMEVPETMETVVCALGLVVGV
AGIITGAIILKTRRPDNIPGCRGP
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtttgagtttgatgaggatgagttctatgtggatctggataagaaggagaccatctgg
catctgccagagtttattcatgtcttcaactttgatgcttggaggggtattgctgacatt
gtcacggcaaagaagaacctgaacactctgatccaacggtccaaccacaccagggccaca
aatgagccacctgaggtggccgtgtttcccaaggagcctgtggagcttggacagcccaac
accctcatctgccatgtggacaagttcttcccacctgtgctcaatgtcacatggctgtgc
aatgggcagacggtcaccaaaggtgtggctgagagcatcttcctgcctagcacagaattc
aggttccacaagttccactacctgaccttcattcccacggctgaagatgtctatgactgc
aaggtggagcactggggcctggaccagccgctccttcagcactgggaggcccaggagcct
atggaggtgcctgagacaatggagactgtggtctgtgccctgggcctggtggtgggcgtg
gcaggcatcatcactggcgccatcatcctgaagaccaggaggcccgacaacatccctggg
tgcaggggcccctag

KEGG   Panthera tigris altaica (Amur tiger): 102966781
Entry
102966781         CDS       T02988                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102966781
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102966781
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102966781
   04612 Antigen processing and presentation
    102966781
   04658 Th1 and Th2 cell differentiation
    102966781
   04659 Th17 cell differentiation
    102966781
   04672 Intestinal immune network for IgA production
    102966781
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102966781
   05322 Systemic lupus erythematosus
    102966781
   05323 Rheumatoid arthritis
    102966781
   05320 Autoimmune thyroid disease
    102966781
   05321 Inflammatory bowel disease
    102966781
   05330 Allograft rejection
    102966781
   05332 Graft-versus-host disease
    102966781
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102966781
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102966781
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102966781
   05152 Tuberculosis
    102966781
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102966781
   05164 Influenza A
    102966781
   05168 Herpes simplex virus 1 infection
    102966781
   05169 Epstein-Barr virus infection
    102966781
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102966781
   05140 Leishmaniasis
    102966781
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102966781
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102966781
  Exosomal proteins of epithelial cells
   102966781
  Exosomal proteins of breast milk
   102966781
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Other DBs
NCBI-GeneID: 102966781
NCBI-ProteinID: XP_015397995
LinkDB
Position
Un
AA seq 264 aa
MVCLCFLGGSWLIALMLILMVLSPPLAWARDTSSHFLTMWKFECHFTNGTERVRFLARYF
YNREELARFDNEVGEYRAVSELGRPGAKYWKGQKDVLEQKRTAVDRFCRHNYGIGEXLQR
RVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFWNGQEEETGVVSTGLIRNGDW
TFQTLVMLETVPQSGEVYTCHVEHPSRMSPITVEWRAQSESAQSKMLSGIGGFVLGLLFL
VVGLFIYFRNSKGHSGLQPTGNAL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggtgtgtctgtgtttcctgggaggttcctggttgatagctctgatgttgatattgatg
gtgctaagccctcccctggcttgggccagggacacttcatcacatttcttaaccatgtgg
aagttcgagtgtcatttcaccaacgggacggagcgggtgcgattcctggccagatatttc
tataaccgggaggagttagctcgctttgacaacgaagttggggagtaccgagcggtatca
gagctggggcgtccaggcgccaagtactggaaggggcagaaggacgtcctggagcagaag
cggacagcggtggaccggttctgcagacacaactacggtattggtgagnagcttcagcgg
cgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcaccacaac
ctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtggttctgg
aacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatggagactgg
accttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctacacctgc
cacgtggagcatccaagtcgcatgagccctatcaccgtggaatggagggctcagtctgaa
tctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctcttcctg
gtggtggggctgttcatctacttccggaattcgaaaggacactctggacttcagccaaca
ggtaatgctctttga

KEGG   Panthera tigris altaica (Amur tiger): 107178930
Entry
107178930         CDS       T02988                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04145  Phagosome
ptg04514  Cell adhesion molecules
ptg04612  Antigen processing and presentation
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107178930
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107178930
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107178930
   04612 Antigen processing and presentation
    107178930
   04658 Th1 and Th2 cell differentiation
    107178930
   04659 Th17 cell differentiation
    107178930
   04672 Intestinal immune network for IgA production
    107178930
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107178930
   05322 Systemic lupus erythematosus
    107178930
   05323 Rheumatoid arthritis
    107178930
   05320 Autoimmune thyroid disease
    107178930
   05321 Inflammatory bowel disease
    107178930
   05330 Allograft rejection
    107178930
   05332 Graft-versus-host disease
    107178930
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107178930
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107178930
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107178930
   05152 Tuberculosis
    107178930
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107178930
   05164 Influenza A
    107178930
   05168 Herpes simplex virus 1 infection
    107178930
   05169 Epstein-Barr virus infection
    107178930
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107178930
   05140 Leishmaniasis
    107178930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    107178930
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107178930
  Exosomal proteins of epithelial cells
   107178930
  Exosomal proteins of breast milk
   107178930
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 107178930
NCBI-ProteinID: XP_007093324
LinkDB
Position
Un
AA seq 254 aa
MPINGVLVLGFLIVAFLMYPQDSGGIKEEHVIIQAEFYLKTDSSGEFMFDFDGDEIFHMD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SVENVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtatcct
caggattccgggggtatcaaagaggagcatgtgatcatccaggctgagttctatctgaag
actgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacatggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgcattggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcccgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcattgacaagttctccccacca
gtgatcaatgtcacatggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggtggagaatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggccttgtcgtgggtctggtgggaatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgcagagggcctctgtga

DBGET integrated database retrieval system