Panthera tigris altaica (Amur tiger): 102954326 Help Entry 102954326         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102954326  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102954326  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102954326    04612 Antigen processing and presentation     102954326    04658 Th1 and Th2 cell differentiation     102954326    04659 Th17 cell differentiation     102954326    04672 Intestinal immune network for IgA production     102954326  09160 Human Diseases   09163 Immune disease    05310 Asthma     102954326    05322 Systemic lupus erythematosus     102954326    05323 Rheumatoid arthritis     102954326    05320 Autoimmune thyroid disease     102954326    05321 Inflammatory bowel disease     102954326    05330 Allograft rejection     102954326    05332 Graft-versus-host disease     102954326   09166 Cardiovascular disease    05416 Viral myocarditis     102954326   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102954326   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102954326    05152 Tuberculosis     102954326   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102954326    05164 Influenza A     102954326    05168 Herpes simplex virus 1 infection     102954326    05169 Epstein-Barr virus infection     102954326   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102954326    05140 Leishmaniasis     102954326  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102954326 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102954326   Exosomal proteins of epithelial cells    102954326   Exosomal proteins of breast milk    102954326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C1-set MHC_II_beta ig Ig_3 Ig_2 C2-set_2 Bac_rhamnosid_C Motif Other DBs NCBI-GeneID:  102954326 NCBI-ProteinID:  XP_007093298 LinkDB All DBs Position Un AA seq 285 aa AA seqDB search MSLSCSRQPTCSETPETVRPSNEMMKVEGGSRMVVLRVPGAPGMAALMMSLMTLSSPLVQ SRDTPELYLYQRRSVCYELNRTHRFLEQYVYNRELFIQFDSDSTAGVFVAESELGRETAK NWNIQKEFLELRRSAVDMVCKHNFEPDEGFTLQRRVQPNVNVSPSKKGHLQHHNLLVCHV SDFYPGHIQVRWFLNGQEETAGVLSTNPIHNGDWTFQMLVMLEMTPQQGDVYTCQVEHPS LDGPVTVEWKAQSDSAQSKMLAGVGGFVLGFVALGVSLLLRFRSR NT seq 858 nt NT seq  +upstreamnt  +downstreamnt atgtcactctcctgctctcgtcagcccacgtgctctgaaactcctgagacagtgaggccc agcaacgagatgatgaaagttgaaggaggctccaggatggtggtcctgagggtccctggg gccccggggatggcagctctcatgatgtccttgatgacgctgagctcccctttggttcag agcagagacaccccagagctttacctctaccagaggcggagtgtctgctacgagttgaac aggacacaccgcttcctggaacaatacgtgtacaacagagagctgttcatccagttcgac agtgacagcaccgcgggggtgtttgtggcggagtctgagctgggccgagaaactgccaag aactggaacatccagaaggagttcctggagctgagacggagcgccgtggacatggtgtgc aagcacaactttgagccggacgagggtttcacgctgcagcgcagagtccagcctaacgtg aacgtctccccctccaagaaggggcacctgcagcaccacaacctgcttgtttgccatgtg tcagatttctatcccggccacattcaagtccgctggttcctgaatggacaggaggaaaca gctggggttttatccactaacccgatccataatggagactggaccttccagatgctggtg atgctggaaatgaccccccagcagggagatgtctacacctgccaggtggagcaccccagc ctggacggtcctgtcaccgtggagtggaaggcacagtctgattctgcccagagcaagatg ctggctggagtcggaggcttcgtgctagggttcgtggctctcggagtgagcctccttctc cgttttagaagccgttga

Panthera tigris altaica (Amur tiger): 102954602 Help Entry 102954602         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DO alpha chain   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102954602  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102954602  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102954602    04612 Antigen processing and presentation     102954602    04658 Th1 and Th2 cell differentiation     102954602    04659 Th17 cell differentiation     102954602    04672 Intestinal immune network for IgA production     102954602  09160 Human Diseases   09163 Immune disease    05310 Asthma     102954602    05322 Systemic lupus erythematosus     102954602    05323 Rheumatoid arthritis     102954602    05320 Autoimmune thyroid disease     102954602    05321 Inflammatory bowel disease     102954602    05330 Allograft rejection     102954602    05332 Graft-versus-host disease     102954602   09166 Cardiovascular disease    05416 Viral myocarditis     102954602   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102954602   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102954602    05152 Tuberculosis     102954602   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102954602    05164 Influenza A     102954602    05168 Herpes simplex virus 1 infection     102954602    05169 Epstein-Barr virus infection     102954602   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102954602    05140 Leishmaniasis     102954602  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102954602 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102954602   Exosomal proteins of epithelial cells    102954602   Exosomal proteins of breast milk    102954602 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  102954602 NCBI-ProteinID:  XP_007093299 LinkDB All DBs Position Un AA seq 250 aa AA seqDB search MVLSGGLVLGLHTLMSLLSPHKAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHLFRKFYYLTFV PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTTETLVCALGLALGLVGFLVGTTLII RGTCLSSAPR NT seq 753 nt NT seq  +upstreamnt  +downstreamnt atggtcctcagtggggggctagtcctgggactccacaccttgatgagcctcctgagcccc cacaaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg gaacgctccaaccgcaccagagccaccaacgtgcctccgagggtgactgtattccccaag tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag accagcttctattcccagcctgaccatctgttccgcaagttctactacctgaccttcgtg ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc ttcaggcactgggagccccagatgcctatcccgctgccagacaccactgagactctggtc tgtgccctcggcctggccctcggcctggtgggctttcttgtgggcaccactctcatcatc agaggcacatgcttgtccagtgcccccaggtaa

Panthera tigris altaica (Amur tiger): 102956041 Help Entry 102956041         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DM alpha chain   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102956041  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102956041  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102956041    04612 Antigen processing and presentation     102956041    04658 Th1 and Th2 cell differentiation     102956041    04659 Th17 cell differentiation     102956041    04672 Intestinal immune network for IgA production     102956041  09160 Human Diseases   09163 Immune disease    05310 Asthma     102956041    05322 Systemic lupus erythematosus     102956041    05323 Rheumatoid arthritis     102956041    05320 Autoimmune thyroid disease     102956041    05321 Inflammatory bowel disease     102956041    05330 Allograft rejection     102956041    05332 Graft-versus-host disease     102956041   09166 Cardiovascular disease    05416 Viral myocarditis     102956041   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102956041   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102956041    05152 Tuberculosis     102956041   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102956041    05164 Influenza A     102956041    05168 Herpes simplex virus 1 infection     102956041    05169 Epstein-Barr virus infection     102956041   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102956041    05140 Leishmaniasis     102956041  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102956041 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102956041   Exosomal proteins of epithelial cells    102956041   Exosomal proteins of breast milk    102956041 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set SKG6 Motif Other DBs NCBI-GeneID:  102956041 NCBI-ProteinID:  XP_007093305 LinkDB All DBs Position Un AA seq 261 aa AA seqDB search MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAILFDKAFCQAMIREIGPKLEGKI PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD GLSFQAFSYLNFTPVPSDLYSCMVTHEIDSYTAIAFWVPHNALPSDLLENVLCGVAFGLG VLGIIVGLVLIIYFRKPCSGD NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct gaaacttatgatggagaccagcttttctccttcgacttttcccagaatacccgagtgcct cgcctacctgaatttgctgactgggctcagaagcttggagatacttctgccattttattt gacaaagcattctgccaggctatgatccgggaaatagggccaaaacttgaagggaaaatc cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac tggcagcatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat ggactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac tcctgcatggtaactcatgagattgacagctacaccgcaattgccttttgggtgccccat aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt gtgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt gattga

Panthera tigris altaica (Amur tiger): 102956510 Help Entry 102956510         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DM beta chain   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102956510  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102956510  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102956510    04612 Antigen processing and presentation     102956510    04658 Th1 and Th2 cell differentiation     102956510    04659 Th17 cell differentiation     102956510    04672 Intestinal immune network for IgA production     102956510  09160 Human Diseases   09163 Immune disease    05310 Asthma     102956510    05322 Systemic lupus erythematosus     102956510    05323 Rheumatoid arthritis     102956510    05320 Autoimmune thyroid disease     102956510    05321 Inflammatory bowel disease     102956510    05330 Allograft rejection     102956510    05332 Graft-versus-host disease     102956510   09166 Cardiovascular disease    05416 Viral myocarditis     102956510   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102956510   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102956510    05152 Tuberculosis     102956510   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102956510    05164 Influenza A     102956510    05168 Herpes simplex virus 1 infection     102956510    05169 Epstein-Barr virus infection     102956510   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102956510    05140 Leishmaniasis     102956510  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102956510 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102956510   Exosomal proteins of epithelial cells    102956510   Exosomal proteins of breast milk    102956510 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set SPARK Motif Other DBs NCBI-GeneID:  102956510 NCBI-ProteinID:  XP_007093308 LinkDB All DBs Position Un AA seq 263 aa AA seqDB search MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSK MVPCEFGVLSVLANYFSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIILSLGLLSW RKASSSGYIFLPGSIYPEGQHIS NT seq 792 nt NT seq  +upstreamnt  +downstreamnt atgaacacactcctgccattgctgctaggcctcagcctgggctccaccagagcaggtggc tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc acatattgtgtctccttcaacaaggatttgctgacctgctgggatccccaaacatccaaa atggtcccttgtgaatttggggtactgagtgtcttggcaaattacttctcagattacctc aatcaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacat acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt gagcccatctgcgaggactggacacctgggctgtccccgatgcagacactgaaggtttcg gtggctgcagtgactctgggcctgggcctcatcattttgtctcttggtttgctcagctgg cggaaagctagctcctctggctacattttcctccctgggtccatttatccagaaggtcaa cacatctcctag

Panthera tigris altaica (Amur tiger): 102958869 Help Entry 102958869         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DO beta chain-like   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102958869  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102958869  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102958869    04612 Antigen processing and presentation     102958869    04658 Th1 and Th2 cell differentiation     102958869    04659 Th17 cell differentiation     102958869    04672 Intestinal immune network for IgA production     102958869  09160 Human Diseases   09163 Immune disease    05310 Asthma     102958869    05322 Systemic lupus erythematosus     102958869    05323 Rheumatoid arthritis     102958869    05320 Autoimmune thyroid disease     102958869    05321 Inflammatory bowel disease     102958869    05330 Allograft rejection     102958869    05332 Graft-versus-host disease     102958869   09166 Cardiovascular disease    05416 Viral myocarditis     102958869   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102958869   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102958869    05152 Tuberculosis     102958869   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102958869    05164 Influenza A     102958869    05168 Herpes simplex virus 1 infection     102958869    05169 Epstein-Barr virus infection     102958869   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102958869    05140 Leishmaniasis     102958869  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102958869 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102958869   Exosomal proteins of epithelial cells    102958869   Exosomal proteins of breast milk    102958869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set C2-set_2 ig Motif Other DBs NCBI-GeneID:  102958869 NCBI-ProteinID:  XP_007093316 LinkDB All DBs Position Un AA seq 299 aa AA seqDB search MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN YKLGAPFTVGRKVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQERVGV MSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRKMLSG IAAFLLGLIFLLVGTVICLRAQKGYVETQLSGDEVMSSSLSLGGQLLSLCFGQRERSWG NT seq 900 nt NT seq  +upstreamnt  +downstreamnt atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc gacgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac aatcggccagatatattggagaggagtaaagcttctgtggatgcactctgcagacataac tacaagctgggtgcacccttcactgtggggagaaaagtgcaaccagaggtggcagtgtat ccagagaggaccccatccctgcaacaccacaatctgctgctttgctctgtgacaggtttc tatccaggggacatcaagatcatgtggttccggaatgggcagcaggagagagtaggggtc atgtccactggccttatcaggaatggagactggacctttcagacaatggtgatgctggaa atgactcctgaacttggagatgtctacacctgccttgttaatcatcccagcctgctgagc cctatttctgtggagtggagagctcagtctgcatattcttggagaaagatgctaagtgga attgcagccttcctgcttgggctgatcttccttctggtggggactgtcatctgcctcagg gctcagaaagggtatgtggagacgcagttgtctggtgatgaggtaatgtcttcttccttg tctttgggtggccaattgttgtccctgtgctttggccagagggagaggtcttggggatag

Panthera tigris altaica (Amur tiger): 102959725 Help Entry 102959725         CDS       T02988                                  Definition (RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102959725  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102959725  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102959725    04612 Antigen processing and presentation     102959725    04658 Th1 and Th2 cell differentiation     102959725    04659 Th17 cell differentiation     102959725    04672 Intestinal immune network for IgA production     102959725  09160 Human Diseases   09163 Immune disease    05310 Asthma     102959725    05322 Systemic lupus erythematosus     102959725    05323 Rheumatoid arthritis     102959725    05320 Autoimmune thyroid disease     102959725    05321 Inflammatory bowel disease     102959725    05330 Allograft rejection     102959725    05332 Graft-versus-host disease     102959725   09166 Cardiovascular disease    05416 Viral myocarditis     102959725   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102959725   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102959725    05152 Tuberculosis     102959725   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102959725    05164 Influenza A     102959725    05168 Herpes simplex virus 1 infection     102959725    05169 Epstein-Barr virus infection     102959725   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102959725    05140 Leishmaniasis     102959725  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102959725 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102959725   Exosomal proteins of epithelial cells    102959725   Exosomal proteins of breast milk    102959725 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2 Motif Other DBs NCBI-GeneID:  102959725 NCBI-ProteinID:  XP_007093321 LinkDB All DBs Position Un AA seq 266 aa AA seqDB search MACLWFPRSFLMAALMVMLMVLSPPLAWARDTPPHFLNMWKAECHFTNGTERVRYLRRHF YNGEEYVRFDSEVGEFRAVTELGRPTAKYWNGQKDFLEGRRTAVDWYCRHNYGVGESFTV QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPLTVEWRVQSESAQSKMLSGIGGFVLGLL FLALGLFIYFRNQKGHSGLPPTGLLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcatgcctgtggttccctagaagtttcctgatggcagctctgatggtaatgctgatg gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaatatgtgg aaggccgagtgccatttcaccaacgggacggagcgggtgcggtacctgcggagacacttc tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgacg gagctggggcggcccactgccaaatactggaacgggcagaaggacttcctggaggggagg cggacagcggtggactggtactgcagacacaactacggtgttggtgagagcttcacggtg cagcggcgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcac cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac acctgccacgtggagcatccaagtcgcacgagccctctcaccgtggaatggagggtacag tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca ccaacaggactcctgagctga

Panthera tigris altaica (Amur tiger): 102960386 Help Entry 102960386         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DR alpha chain   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102960386  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102960386  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102960386    04612 Antigen processing and presentation     102960386    04658 Th1 and Th2 cell differentiation     102960386    04659 Th17 cell differentiation     102960386    04672 Intestinal immune network for IgA production     102960386  09160 Human Diseases   09163 Immune disease    05310 Asthma     102960386    05322 Systemic lupus erythematosus     102960386    05323 Rheumatoid arthritis     102960386    05320 Autoimmune thyroid disease     102960386    05321 Inflammatory bowel disease     102960386    05330 Allograft rejection     102960386    05332 Graft-versus-host disease     102960386   09166 Cardiovascular disease    05416 Viral myocarditis     102960386   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102960386   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102960386    05152 Tuberculosis     102960386   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102960386    05164 Influenza A     102960386    05168 Herpes simplex virus 1 infection     102960386    05169 Epstein-Barr virus infection     102960386   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102960386    05140 Leishmaniasis     102960386  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102960386 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102960386   Exosomal proteins of epithelial cells    102960386   Exosomal proteins of breast milk    102960386 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  102960386 NCBI-ProteinID:  XP_007093322 LinkDB All DBs Position Un AA seq 254 aa AA seqDB search MAVSRAPVLGFFIMALLMGPQESLAIKEEHVIIQAEFYMKPDSSGEFMFDFDGDEIFHVD MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP SVEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK GMRKVNAGERRGPL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggctgtaagtagagccccagtgctaggatttttcatcatggctttactgatgggtcct caagaatcattggctatcaaagaagagcatgtgatcatccaggctgagttctatatgaag cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag gcccagggtgcattggccaatatagctgtggacaaagctaacctggacatcttgataaag cgctccaacaacaccccaaacaccaatgaacctcccgaggtgactgtgctctcaaacagc cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc tcggtggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt gccctgggccttgtcgtgggtctggtgggaatcattgttggaaccatcttcatcatcaag ggcatgcgcaaggtcaatgctggtgaacgcagagggcctctgtga

Panthera tigris altaica (Amur tiger): 102961248 Help Entry 102961248         CDS       T02988                                  Definition (RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102961248  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102961248  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102961248    04612 Antigen processing and presentation     102961248    04658 Th1 and Th2 cell differentiation     102961248    04659 Th17 cell differentiation     102961248    04672 Intestinal immune network for IgA production     102961248  09160 Human Diseases   09163 Immune disease    05310 Asthma     102961248    05322 Systemic lupus erythematosus     102961248    05323 Rheumatoid arthritis     102961248    05320 Autoimmune thyroid disease     102961248    05321 Inflammatory bowel disease     102961248    05330 Allograft rejection     102961248    05332 Graft-versus-host disease     102961248   09166 Cardiovascular disease    05416 Viral myocarditis     102961248   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102961248   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102961248    05152 Tuberculosis     102961248   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102961248    05164 Influenza A     102961248    05168 Herpes simplex virus 1 infection     102961248    05169 Epstein-Barr virus infection     102961248   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102961248    05140 Leishmaniasis     102961248  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102961248 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102961248   Exosomal proteins of epithelial cells    102961248   Exosomal proteins of breast milk    102961248 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2 Motif Other DBs NCBI-GeneID:  102961248 NCBI-ProteinID:  XP_007093326 LinkDB All DBs Position Un AA seq 266 aa AA seqDB search MVCLCFLGGSWMTALMLILMVLSPPLAWARDTPPHFLLLGKTECHFTNGTELVRFLDRYF YNGEEYVRFDSDVGEYRAVTELGRPDAKYWNGLKDYMEQARTAVDWYCRHNYGVGESFTV QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL FLVVGLFIYFRNQKGHSGLQPTGLLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgcctgtgtttcctgggaggctcctggatgacagctctgatgttgatattgatg gtgctgagccctcccctggcttgggccagggacaccccaccacatttcttgttgctgggg aagaccgagtgccatttcaccaacgggacggagctggtgcgattcctggacagatacttc tataacggggaggagtatgtgcgcttcgacagcgatgtaggggagtaccgggcggtgacg gagctggggcggcctgacgccaagtactggaatgggctgaaggactacatggagcaggcg cggacagcggtggactggtactgcagacacaactacggtgttggtgagagcttcacggtg cagcggcgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcac cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggctcag tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag ccaacaggactcctgagctga

Panthera tigris altaica (Amur tiger): 102966493 Help Entry 102966493         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102966493  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102966493  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102966493    04612 Antigen processing and presentation     102966493    04658 Th1 and Th2 cell differentiation     102966493    04659 Th17 cell differentiation     102966493    04672 Intestinal immune network for IgA production     102966493  09160 Human Diseases   09163 Immune disease    05310 Asthma     102966493    05322 Systemic lupus erythematosus     102966493    05323 Rheumatoid arthritis     102966493    05320 Autoimmune thyroid disease     102966493    05321 Inflammatory bowel disease     102966493    05330 Allograft rejection     102966493    05332 Graft-versus-host disease     102966493   09166 Cardiovascular disease    05416 Viral myocarditis     102966493   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102966493   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102966493    05152 Tuberculosis     102966493   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102966493    05164 Influenza A     102966493    05168 Herpes simplex virus 1 infection     102966493    05169 Epstein-Barr virus infection     102966493   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102966493    05140 Leishmaniasis     102966493  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102966493 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102966493   Exosomal proteins of epithelial cells    102966493   Exosomal proteins of breast milk    102966493 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C1-set MHC_II_alpha Ig_3 Marek_A Motif Other DBs NCBI-GeneID:  102966493 NCBI-ProteinID:  XP_015397998 LinkDB All DBs Position Un AA seq 204 aa AA seqDB search MFEFDEDEFYVDLDKKETIWHLPEFIHVFNFDAWRGIADIVTAKKNLNTLIQRSNHTRAT NEPPEVAVFPKEPVELGQPNTLICHVDKFFPPVLNVTWLCNGQTVTKGVAESIFLPSTEF RFHKFHYLTFIPTAEDVYDCKVEHWGLDQPLLQHWEAQEPMEVPETMETVVCALGLVVGV AGIITGAIILKTRRPDNIPGCRGP NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgtttgagtttgatgaggatgagttctatgtggatctggataagaaggagaccatctgg catctgccagagtttattcatgtcttcaactttgatgcttggaggggtattgctgacatt gtcacggcaaagaagaacctgaacactctgatccaacggtccaaccacaccagggccaca aatgagccacctgaggtggccgtgtttcccaaggagcctgtggagcttggacagcccaac accctcatctgccatgtggacaagttcttcccacctgtgctcaatgtcacatggctgtgc aatgggcagacggtcaccaaaggtgtggctgagagcatcttcctgcctagcacagaattc aggttccacaagttccactacctgaccttcattcccacggctgaagatgtctatgactgc aaggtggagcactggggcctggaccagccgctccttcagcactgggaggcccaggagcct atggaggtgcctgagacaatggagactgtggtctgtgccctgggcctggtggtgggcgtg gcaggcatcatcactggcgccatcatcctgaagaccaggaggcccgacaacatccctggg tgcaggggcccctag

Panthera tigris altaica (Amur tiger): 102966781 Help Entry 102966781         CDS       T02988                                  Definition (RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102966781  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102966781  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102966781    04612 Antigen processing and presentation     102966781    04658 Th1 and Th2 cell differentiation     102966781    04659 Th17 cell differentiation     102966781    04672 Intestinal immune network for IgA production     102966781  09160 Human Diseases   09163 Immune disease    05310 Asthma     102966781    05322 Systemic lupus erythematosus     102966781    05323 Rheumatoid arthritis     102966781    05320 Autoimmune thyroid disease     102966781    05321 Inflammatory bowel disease     102966781    05330 Allograft rejection     102966781    05332 Graft-versus-host disease     102966781   09166 Cardiovascular disease    05416 Viral myocarditis     102966781   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102966781   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102966781    05152 Tuberculosis     102966781   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102966781    05164 Influenza A     102966781    05168 Herpes simplex virus 1 infection     102966781    05169 Epstein-Barr virus infection     102966781   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102966781    05140 Leishmaniasis     102966781  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102966781 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102966781   Exosomal proteins of epithelial cells    102966781   Exosomal proteins of breast milk    102966781 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig DUF202 Motif Other DBs NCBI-GeneID:  102966781 NCBI-ProteinID:  XP_015397995 LinkDB All DBs Position Un AA seq 264 aa AA seqDB search MVCLCFLGGSWLIALMLILMVLSPPLAWARDTSSHFLTMWKFECHFTNGTERVRFLARYF YNREELARFDNEVGEYRAVSELGRPGAKYWKGQKDVLEQKRTAVDRFCRHNYGIGEXLQR RVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFWNGQEEETGVVSTGLIRNGDW TFQTLVMLETVPQSGEVYTCHVEHPSRMSPITVEWRAQSESAQSKMLSGIGGFVLGLLFL VVGLFIYFRNSKGHSGLQPTGNAL NT seq 795 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtctgtgtttcctgggaggttcctggttgatagctctgatgttgatattgatg gtgctaagccctcccctggcttgggccagggacacttcatcacatttcttaaccatgtgg aagttcgagtgtcatttcaccaacgggacggagcgggtgcgattcctggccagatatttc tataaccgggaggagttagctcgctttgacaacgaagttggggagtaccgagcggtatca gagctggggcgtccaggcgccaagtactggaaggggcagaaggacgtcctggagcagaag cggacagcggtggaccggttctgcagacacaactacggtattggtgagnagcttcagcgg cgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcaccacaac ctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtggttctgg aacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatggagactgg accttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctacacctgc cacgtggagcatccaagtcgcatgagccctatcaccgtggaatggagggctcagtctgaa tctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctcttcctg gtggtggggctgttcatctacttccggaattcgaaaggacactctggacttcagccaaca ggtaatgctctttga

Panthera tigris altaica (Amur tiger): 107178930 Help Entry 107178930         CDS       T02988                                  Definition (RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like   KO K06752   MHC class II antigen Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagosome ptg04514   Cell adhesion molecules ptg04612   Antigen processing and presentation ptg04640   Hematopoietic cell lineage ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05145   Toxoplasmosis ptg05150   Staphylococcus aureus infection ptg05152   Tuberculosis ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05310   Asthma ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     107178930  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107178930  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     107178930    04612 Antigen processing and presentation     107178930    04658 Th1 and Th2 cell differentiation     107178930    04659 Th17 cell differentiation     107178930    04672 Intestinal immune network for IgA production     107178930  09160 Human Diseases   09163 Immune disease    05310 Asthma     107178930    05322 Systemic lupus erythematosus     107178930    05323 Rheumatoid arthritis     107178930    05320 Autoimmune thyroid disease     107178930    05321 Inflammatory bowel disease     107178930    05330 Allograft rejection     107178930    05332 Graft-versus-host disease     107178930   09166 Cardiovascular disease    05416 Viral myocarditis     107178930   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     107178930   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     107178930    05152 Tuberculosis     107178930   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107178930    05164 Influenza A     107178930    05168 Herpes simplex virus 1 infection     107178930    05169 Epstein-Barr virus infection     107178930   09174 Infectious disease: parasitic    05145 Toxoplasmosis     107178930    05140 Leishmaniasis     107178930  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     107178930 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107178930   Exosomal proteins of epithelial cells    107178930   Exosomal proteins of breast milk    107178930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  107178930 NCBI-ProteinID:  XP_007093324 LinkDB All DBs Position Un AA seq 254 aa AA seqDB search MPINGVLVLGFLIVAFLMYPQDSGGIKEEHVIIQAEFYLKTDSSGEFMFDFDGDEIFHMD MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP SVENVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK GMRKVNAGERRGPL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atgcccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtatcct caggattccgggggtatcaaagaggagcatgtgatcatccaggctgagttctatctgaag actgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacatggat atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag gcccagggtgcattggccaatatagctgtggacaaagctaacctggacatcttgataaag cgctccaacaacaccccaaacaccaatgaacctcccgaggtgactgtgctctcaaacagc cctgtggaactgggagagcccaacatcctcatctgtttcattgacaagttctccccacca gtgatcaatgtcacatggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc tcggtggagaatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt gccctgggccttgtcgtgggtctggtgggaatcattgttggaaccatcttcatcatcaag ggcatgcgcaaggtcaatgctggtgaacgcagagggcctctgtga

DBGET integrated database retrieval system