KEGG   Panthera tigris altaica (Amur tiger): 102954346
Entry
102954346         CDS       T02988                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1
  KO
K07818  perforin 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04210  Apoptosis
ptg04650  Natural killer cell mediated cytotoxicity
ptg04940  Type I diabetes mellitus
ptg05320  Autoimmune thyroid disease
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102954346 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102954346 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102954346 (PRF1)
   05330 Allograft rejection
    102954346 (PRF1)
   05332 Graft-versus-host disease
    102954346 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102954346 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102954346 (PRF1)
SSDB
Motif
Pfam: MACPF C2
Other DBs
NCBI-GeneID: 102954346
NCBI-ProteinID: XP_015399074
LinkDB
Position
Un
AA seq 382 aa
MFLSPFSSHLVHSPPLHPNFQRVVRDLPPDFNTSTEADYLRLISNYGTHFIRSMELGGRI
SALTALRTCELALDGLGAKEVEDCLAVEAQVSISGRASSSSEFKACEEKKKHHKITTSFH
QAYRERFSEIVGGHHTSVSDLLFGDQAGPEQFSAWVASLLDRPSLVDYTLEPLHVLLESQ
DPRREALRQAVSKYVMDRARWKDCSRPCPLGQKKSPHNPCQCVCHGSAVTNQDCCPRQRG
LAHLEVMNFQASGLWGDSFTRTDAYLKVFFGGQELRVSTVWNDNNPKWMTRLDFGDVILS
TGGPLRVQVWDQDHGWDDDLLGTCDQNPQSGLHEVKCGLSHGRLRFSYHAKCLPHLKGAT
CLEYAPHGLLGELPGNRSGPVW
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtttctctctccctttagctctcacctggtacactctcccccactccaccccaatttc
cagagggtcgtcagagacctgccccccgacttcaacacctccaccgaggccgactacctc
cggctcatctccaactacggcacccacttcatccggtccatggagctgggcggccggatc
tcggccctcaccgccctgcgcacctgtgagctggccctggacgggctcggggccaaagag
gtggaggactgcctggccgtcgaggcccaggtcagcataagtggccgtgccagctcttca
tcggaattcaaggcctgcgaggagaagaagaagcaccacaagataaccacctccttccac
caggcctatcgggagcgcttttccgaaatagttggtggccaccacacctccgtaagtgac
ctgctgtttggggaccaggccgggcccgagcagttctccgcctgggtggcctcgctgctg
gacagacccagcctggtggactacaccctggagcctctgcatgtgctcctggagagccag
gacccgcggcgggaggccctgcgacaggccgtgagcaagtacgtgatggacagggcccgc
tggaaggactgtagcaggccttgccccctggggcagaagaagagcccccacaacccatgc
cagtgtgtctgccacggctcagcggtcaccaaccaggactgctgtccccggcagaggggc
ctggcccacttggaggtcatgaacttccaggcgtcaggcctgtggggagactctttcact
aggacggacgcctacctgaaggtcttctttggaggccaggagctgagagtgagcacagtg
tggaacgataacaaccccaagtggatgacgcggctggacttcggggacgtgatcctgtcc
acgggggggcccctgagggtgcaggtctgggaccaagaccacggctgggacgatgacctc
ctcggcacctgtgaccagaacccacagtctggcttgcacgaggtgaagtgtggcctgtcc
cacggtcgcctgagattctcctaccatgccaagtgcttgcctcacctgaagggggccacc
tgcctggagtacgccccccacggtcttctgggggagcttcccggaaaccggagtgggccg
gtgtggtga

DBGET integrated database retrieval system