KEGG   Panthera tigris altaica (Amur tiger): 102954471
Entry
102954471         CDS       T02988                                 

Gene name
SMS
Definition
(RefSeq) spermine synthase
  KO
K00802  spermine synthase [EC:2.5.1.22]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00330  Arginine and proline metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102954471 (SMS)
   00330 Arginine and proline metabolism
    102954471 (SMS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102954471 (SMS)
Enzymes [BR:ptg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.22  spermine synthase
     102954471 (SMS)
SSDB
Motif
Pfam: Spermine_synth SpmSyn_N Spermine_synt_N DUF43 Citrate_bind MTS
Other DBs
NCBI-GeneID: 102954471
NCBI-ProteinID: XP_015395587
LinkDB
Position
Un
AA seq 331 aa
MTESVHTWQDHGYLATYINKNGSFANLRIYPHGLVLLDLQSYDGDSQGQEVDSLLNKVEE
RMKELSRDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHS
KQFGNILILSGDVNLAESDLAYTQAIMGSGKEDYSGKDVLILGGGDGGILCEIVKLKPKM
VTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVIN
DLTAVPISTSPEEDSTWEFLRLILDLSMKVLKPDGKYFTQGNCVNLTEALSLYEEQLGRL
YCPVEFSKEIVCVPSYLELWVFYTVWKKANP
NT seq 996 nt   +upstreamnt  +downstreamnt
atgacggagtcggtgcatacctggcaagaccatggttatttagcgacctacataaacaaa
aacggcagttttgccaatttgagaatttacccacatggactggtgttattggaccttcag
agttatgatggtgattcacaaggccaagaagttgacagtcttctgaacaaagtagaagaa
agaatgaaagaattgagtcgggacagtactggacgggtgaagcgattaccacccatagtt
cgaggaggggccatcgacagatactggcccactgctgatggtcgcctggttgagtatgac
atagatgaagtggtgtatgatgaagattcaccttatcagaacattaaaattctacactca
aagcaatttggaaacattctcatccttagtggggatgttaatctggcggagagtgatttg
gcgtatacccaggccatcatgggcagtggaaaagaagactacagtggcaaagacgtgctc
attctagggggcggagatgggggcatattatgtgaaatagtcaaactgaaaccaaagatg
gtcactatggtagagattgaccaaatggtgattgatggatgtaagaaatacatgcgaaaa
acatgtggcgacgtcttagacaatcttaaaggagactgctatcaggttctaatagaagac
tgtattccagtactgaagaggtacgccaaagaagggagagagtttgattatgtgattaat
gatttgacagctgttccaatctccacatctccagaagaagattctacatgggagtttctc
agactgattcttgacctctcgatgaaagtactgaaaccggatgggaagtattttacacag
ggtaactgtgtcaatttgacagaagccttgtcgctctatgaagaacagcttgggcgcctg
tattgtcctgtggaattctcaaaggagatcgtctgtgttccttcatacttggaattgtgg
gtattttacactgtttggaagaaagctaacccttga

DBGET integrated database retrieval system