KEGG   Panthera tigris altaica (Amur tiger): 102954528
Entry
102954528         CDS       T02988                                 

Gene name
CD86
Definition
(RefSeq) CD86 molecule
  KO
K05413  CD86 antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04514  Cell adhesion molecules
ptg04620  Toll-like receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05202  Transcriptional misregulation in cancer
ptg05320  Autoimmune thyroid disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102954528 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102954528 (CD86)
   04672 Intestinal immune network for IgA production
    102954528 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102954528 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102954528 (CD86)
   05323 Rheumatoid arthritis
    102954528 (CD86)
   05320 Autoimmune thyroid disease
    102954528 (CD86)
   05330 Allograft rejection
    102954528 (CD86)
   05332 Graft-versus-host disease
    102954528 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102954528 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102954528 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102954528 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102954528 (CD86)
   04090 CD molecules [BR:ptg04090]
    102954528 (CD86)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102954528 (CD86)
CD molecules [BR:ptg04090]
 Proteins
  102954528 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 C2-set_2 I-set
Other DBs
NCBI-GeneID: 102954528
NCBI-ProteinID: XP_007098382
LinkDB
Position
Un
AA seq 331 aa
MDLGCTMGLSRTLLVMALLLSGVSSMKSQAYFNKTGELPCHFTNSQNISLDELVVFWQDQ
DKLVLYELFRGKENPQNVHLKYKGRTSFDKDNWTLRLHNVQIKDKGTYHCFIHYKGPKGL
VPMHQMSSDLSVLANFSQPEITVTSNRTENSGIINLTCSSIQGYPEPKEMYFQLNTENST
TKYDTVMKKTQNNVTELYNVSISLPFSVPEAHNVSVFCALKLETLEMLLSLPFNIDAQPK
DKDPEQGHFLWIAAVLVMFVVFCGMVSFKTLRKRKKKQPGPSHECETIKGERKESKQTNE
RVPYHVPERSDEAQCVNILKTASGDKSTTHF
NT seq 996 nt   +upstreamnt  +downstreamnt
atggatctcgggtgcactatgggactgagtcgcactctccttgtgatggccctcctgctc
tctggtgtttcttccatgaagagtcaagcatatttcaacaagactggagaactgccatgc
cattttacaaactctcaaaacataagcctggatgagctggtagtattttggcaggaccag
gataagctggttctgtatgagctattcagaggcaaagagaaccctcaaaatgttcatctc
aaatataagggccgtacaagctttgacaaggacaactggaccctgagactccacaatgtt
cagatcaaggacaagggcacatatcactgtttcattcattataaagggcccaaaggacta
gttcccatgcaccaaatgagttctgacctatcagtgcttgctaacttcagtcaacctgaa
ataacagtaacttctaatagaacagaaaattctggcatcataaatttgacctgctcatct
atacaaggttacccagaacctaaggagatgtattttcagctaaacactgagaattcaact
actaagtatgatactgtcatgaagaaaactcaaaataatgtgacagaactgtacaacgtt
tctatcagcttgcctttttcagtccctgaagcacacaatgtgagcgtcttttgtgccctg
aaactggagacactggagatgctgctctccctacctttcaatatagatgcacaacctaag
gataaagaccctgaacaaggccacttcctctggattgcggctgtacttgtaatgtttgtt
gttttttgtgggatggtgtcctttaaaacactaaggaaaaggaagaagaagcagcctggc
ccctctcatgaatgtgaaaccatcaaaggggagagaaaagagagcaaacagaccaatgaa
agagtaccataccacgtacctgagagatctgatgaagcccagtgtgttaacattttgaag
acagcctcaggcgacaaaagtactacacatttttaa

KEGG   Panthera tigris altaica (Amur tiger): 102965184
Entry
102965184         CDS       T02988                                 

Gene name
CD80
Definition
(RefSeq) CD80 molecule
  KO
K05412  CD80 antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04514  Cell adhesion molecules
ptg04620  Toll-like receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05320  Autoimmune thyroid disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102965184 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102965184 (CD80)
   04672 Intestinal immune network for IgA production
    102965184 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102965184 (CD80)
   05323 Rheumatoid arthritis
    102965184 (CD80)
   05320 Autoimmune thyroid disease
    102965184 (CD80)
   05330 Allograft rejection
    102965184 (CD80)
   05332 Graft-versus-host disease
    102965184 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102965184 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102965184 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102965184 (CD80)
CD molecules [BR:ptg04090]
 Proteins
  102965184 (CD80)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set C1-set V-set Ig_2 ig Izumo-Ig
Other DBs
NCBI-GeneID: 102965184
NCBI-ProteinID: XP_007098424
LinkDB
Position
Un
AA seq 292 aa
MDQAAKWKTPLLKHPYPKLFPLLMLASLFYFCSGIIQVNKTVEEVAVLSCDYNISTKELT
EIRIYWQKDDEMVLAVMSGKVQVWPKYKNRTFTDVTDNHSIVIMALRLSDNGKYTCIIQK
IEKGSYKVKHLTSVMLLVRADFPVPSITDLGNPSHNIKRIMCLTSGGFPKPHLSWLENEE
ELNAVNTTVSQDPETELYTISSELDFNMTNNHSFLCLVKYGNLIVSQIFNWQKSEPQPSN
NQLWIIILSSVVSGIVVITALTLRCLVHRPAARWRQREMGRARKWKRSHLST
NT seq 879 nt   +upstreamnt  +downstreamnt
atggatcaagcagcaaagtggaaaacaccactactgaagcacccatatcccaagctcttt
ccgctcttgatgctagctagtcttttttacttctgttcaggtatcatccaggtgaacaag
acagtggaagaagtagcagtactatcctgtgattacaacatttccaccaaagaactgacg
gaaattcgaatctattggcaaaaggatgatgaaatggtgttggctgtcatgtctggcaaa
gtgcaagtgtggcccaagtacaagaaccgcacattcactgatgtcaccgataaccactcc
attgtgatcatggctctgcgcctgtcagacaatggcaaatacacctgtatcattcaaaag
attgaaaaagggtcttacaaagtgaaacacctgacttcggtgatgttattggtcagagct
gacttccctgtccctagtataactgatcttggaaatccatctcataacatcaaaaggata
atgtgcttaacttctggaggttttccaaagcctcacctctcctggttggaaaatgaagaa
gaattaaatgccgtcaacacaacagtttcccaagatcctgaaactgagctctacactatt
agcagtgaactggatttcaatatgacaaacaaccatagcttcctgtgtcttgtcaagtat
ggaaacttaatagtatcacagatcttcaactggcaaaaatcagagccacagccttctaat
aatcagctctggatcattatcctgagctcagtagtaagtgggattgttgtgatcactgca
cttaccttaagatgcctagtccacagacctgctgcaaggtggagacaaagagaaatgggg
agagcgcggaaatggaaaagatctcacctgtctacatag

DBGET integrated database retrieval system