KEGG   Panthera tigris altaica (Amur tiger): 102954761
Entry
102954761         CDS       T02988                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 3-like
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04217  Necroptosis
ptg04621  NOD-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05164  Influenza A
ptg05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102954761
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102954761
   04625 C-type lectin receptor signaling pathway
    102954761
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102954761
   05135 Yersinia infection
    102954761
   05133 Pertussis
    102954761
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102954761
   05164 Influenza A
    102954761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102954761
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ptg04054]
    102954761
Membrane trafficking [BR:ptg04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    102954761
Pattern recognition receptors [BR:ptg04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   102954761
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN NOD2_WH FISNA LRR_6 LRR_4 NB-ARC AAA_16
Other DBs
NCBI-GeneID: 102954761
NCBI-ProteinID: XP_015395712
LinkDB
Position
Un
AA seq 886 aa
MNMASVRCKLARYLEDLGDTDFKKFKMHLEDYPSQKGFSPLPRSQTEKADHMDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPQWDNAHVVYREESLEEEWMGLFGYLSRI
SICKKKKDYCKKYKKHVRSRFQCIKDRNARLGESVNLNKRYTRLRLVKEHKNQQEREHEL
LAIGRTSAKMLDSPVSSLNVELLFEPDDQHSEPVHTVVFQGAAGIGKTILARKIMLDWAS
EKIYQDRFDYLFYIHCREVSLGTRRSLGDLIVSCCPDPNPPICKIVSKPSRILFLMDGFD
ELQGAFDEHTEALCTNWQKVERGDILLSSLIRKRLLPEASLLITTRPVALEKLQHLLDRP
RHVEILGFSEAKRKEYFFKYFSDEQQAREAFRLIQENEILFTMCFIPLVCWIVCTGLKQQ
MDSGKSLAQTSKTTTAVYIFFLSTLLQSRRGNQNHDVSTNLRGLCSLAADGIWNQKILFE
ECDLRNHGLQKADVSAFLRINLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEGQGDTG
SLLLSGSKLPNRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQI
RLELLKWIEKKAKAKNLQIQPSQLELFYCLYEMQEEDFVQKAMGHFPQIDINLSTRMDHV
VSSFCIENCQGVESLSLRLLHNSPKEEEEEEEEEVQHCEVDHCVLLDHHAAYTHRLVNCH
LTVSLWQGLFSVLSTSWNLTELNLSDNALGDPGMMVLCEMLQRPGCNVQRLWLGRCCLSY
QCCFNISSVLSSNQKLVELDLSHNSLGDFGIRLLCVGLRHVFCNLKKLWLVSCCLTSACC
EDLASVLSTSQSLTRLYLGENALGDSGVGILCEKAKHPQCKLQKLG
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgaacatggcaagtgtccgctgcaagttggcccgttacctggaggatttgggggacaca
gactttaagaaattcaagatgcacttagaagactacccttctcaaaaggggttcagccca
ctccctcggagtcagacagagaaggcagaccacatggatctagctactttgatgattgac
ttcaacggtgaggagaaggcatgggccatggcagtgtggatttttgctgcaatcaacagg
agagacctttatgaaaaagctaagagggatgagccacagtgggataatgcacatgtggta
taccgggaagaaagccttgaagaagagtggatgggtttattcgggtacctatccagaatc
tctatttgtaaaaaaaagaaggattactgtaagaagtacaaaaaacatgtgaggagcaga
ttccagtgtatcaaagataggaatgctcgtctgggtgagagcgtgaacctcaacaaacgc
tataccaggctgcgtcttgtcaaggaacacaagaaccagcaagagagggaacatgagctc
ctggccattggcaggacttcagccaagatgctggacagccctgtgagctccctgaatgtg
gaattactgtttgagcctgacgaccaacactctgagcctgttcacacggtggtattccag
ggagcagcaggcattgggaaaacaatactggcaaggaagatcatgttggactgggcatca
gagaaaatttaccaggacaggtttgactatttgttttatatccactgtcgggaagtgagt
ctcgggacacggaggagcctgggagacctgattgtcagctgctgcccagatccaaaccca
cccatatgcaagattgtgagcaagccttctcggattctcttcctcatggatggcttcgat
gaacttcagggtgcctttgatgagcacacagaggcgctctgtacaaactggcagaaggta
gagaggggagacattctcctgagcagcctcatcagaaagaggctgcttcccgaggcctct
ttacttatcaccacgagacctgtggctctggagaaactacagcatttgctggaccggccc
cgtcatgtggagatcctgggtttctcagaggccaaaagaaaggaatactttttcaagtat
ttctcagatgagcagcaagccagggaggccttcaggctgattcaggagaatgagatcctc
ttcaccatgtgctttatccccttggtctgctggattgtgtgcactgggttgaagcagcag
atggacagtggcaagagtcttgcccagacatccaagaccaccactgcagtgtacatcttc
ttcctctccactttgttgcaatcccgcagagggaaccagaaccacgatgtctctactaac
ctccggggtctctgttccttggccgcagatggaatctggaaccagaaaatcctgtttgag
gagtgcgaccttaggaatcatggccttcagaaggcagatgtatctgctttcttgaggatc
aacctattccagaaggaagtggactgcgagaaattctacagcttcatccacatgaccttc
caggaattctttgctgccatgtactacttgctggaagaggagggacagggagacacaggg
agcttgctgttgagtggttccaagcttcccaaccgagatgtgacagtccttctggaaaac
tatggcaagtttgaaaaggggtatctgattttcgttgtccgtttcctctttggccttgta
aaccaggagagaacctcctacttggagaaaaaactgagttgcaagatctctcagcaaatc
aggctggagctgctaaaatggattgaaaagaaagccaaggccaagaatctgcagatccag
cccagccagttggagttgttctactgtctatatgagatgcaagaggaggactttgtgcaa
aaggccatgggccatttcccccaaattgacatcaatctctctaccagaatggaccatgta
gtttcttctttttgtattgagaactgtcaaggtgtggaatcactttccctgaggttgctt
cataactctccaaaggaagaggaggaggaagaggaggaggaagtgcaacactgtgaggtg
gaccactgtgtcctcctagatcatcatgctgcctatactcaccggttggtgaactgccat
ctcactgttagcctttggcagggtctcttctcagtcctaagcactagctggaacctcacg
gaactgaacctcagtgacaatgctctgggggacccagggatgatggtgttatgtgagatg
ctccagcgtcctggctgtaatgttcagagattgtggttggggcggtgttgcctttcctat
cagtgctgcttcaacatctcctcggtcctaagcagcaatcagaagctggtagaattggat
ctgagccacaacagcttgggagattttggaatcagacttctttgtgtgggactgaggcat
gtattctgcaatctgaagaagctctggttggtcagttgctgtctcacatcagcatgttgt
gaggacctggcatccgtcttgagcaccagccagtccctgaccagactctacttgggggaa
aatgcgctgggagactcaggagttggaattctatgtgaaaaagcaaagcatccacaatgt
aagctgcagaaactggggtaa

DBGET integrated database retrieval system