KEGG   Panthera tigris altaica (Amur tiger): 102954864
Entry
102954864         CDS       T02988                                 

Gene name
OPLAH
Definition
(RefSeq) 5-oxoprolinase (ATP-hydrolysing)
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102954864 (OPLAH)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     102954864 (OPLAH)
SSDB
Motif
Pfam: Hydantoinase_B Hydant_A_N
Other DBs
NCBI-GeneID: 102954864
NCBI-ProteinID: XP_015397257
LinkDB
Position
Un
AA seq 609 aa
MGSPEGRFHFAIDRGGTFTDVFAQCPGGQVRVLKLLSEDPANYADAPTEGIRRILEQEGG
VLLPRDQPLDPSRRGGERVALLVTRGFRDLLHVGTQAREDLFDLAVPMPEVLYEEVLEVD
ERVVLYRGEPGAGTPVKGRGWAGALGGGLEAVGKRRSAVXGRHYRWAQHEQQVGALAREL
GFTHVSLSSDTMPMVRIVPRGHTACANTYLTPTIQRLQGAREPCSLPYAPETFVQLDQRL
SRLEEQCVDALRAQGFPRGRGMEGLHLGTSLIPHPPQVTQCYFEGGYQETPVYLLGELAY
GHKLQGPCLIIDSNSTILVEPGCQAEVTDTGDIRISVGAEVPSLVGAQLDPIHLSIFSHR
FMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQI
QHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQTRPVFYVASRGHHADIGGITP
GSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEALQAPGKIPGCSGTRNLHDNLSDLR
AQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAEPAGRGKPAGLRNLPAGLLMPAFP
LQRLPVCTS
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgggcagccccgaggggcgtttccatttcgccatcgaccgtggaggcaccttcacagat
gtctttgcccagtgccccggggggcaagtgagggtcttgaagctgctctcagaggacccc
gccaactatgcagacgcccctactgagggcatccgccgcatcctggagcaggaaggaggc
gtgctgttgccgcgggaccagccgctggaccccagccgccgggggggggagcgggtggcg
ctgctggtgacacgtggcttccgagacctgctgcacgtgggcacccaggcccgagaggac
ctctttgacctggctgtgcccatgcctgaggtgctgtacgaagaggtgctggaggtggac
gagcgtgtggtgctgtatcgcggggagccaggtgcagggacacctgtcaaaggtcgtggc
tgggccggggctctgggcggtgggctggaggccgtgggcaagaggcggagcgccgtgnng
ggtcgtcattacaggtgggcccagcatgagcagcaggtgggcgcactggcccgggagctg
ggcttcacccacgtgtcactgtcctcggacaccatgcccatggtgcgcatcgtgcctcgg
gggcacacagcctgtgccaacacctaccttacccccaccatccagcggttgcagggggca
cgggagccgtgttccttgccctacgcgcctgagacctttgtgcagctggaccagaggctg
agccgcctggaggagcagtgtgtggacgccctgcgggcccagggctttcccagggggagg
ggcatggaggggctgcacctaggaacctcactcatcccacaccctcctcaggtgacccag
tgctactttgaggggggctaccaggagacccctgtgtacctgctgggagagctggcctat
gggcacaagcttcaggggccctgcctcatcatcgacagcaacagcaccatcctggtggag
ccaggctgccaggcagaggtgactgataccggggacatccgcatctctgtgggggctgaa
gtcccgagcctggtgggcgcccagcttgaccccatccacctgtccatcttctctcaccgc
ttcatgagcattgctgagcagatgggccgcatcctgcagcgcacagccatctccaccaac
atcaaggagcgtctggacttctcctgtgccctcttcgggcccgatggggggctggtatcc
aacgccccccacatccccgtgcacctgggcgccatgcaggagaccgtacagttccagatc
cagcacctgggggccgacctccaccctggtgacgtgctgctgagcaaccacccgagcgct
gggggcagccacctgccagacctgaccgtcatcaccccggtgttttggccgggtcagact
cggcctgtgttctacgtggcaagccgtgggcaccatgcggacattgggggcatcacgcca
ggctccatgcctccccactccaccacactgcagcaggagggcgccgtctttctgtctttc
aaactcgtccagggaggagtcttccaagaggaggcggtaactgaggccctgcaggcccca
ggcaagattcccggctgcagcggcacgaggaacttgcacgacaacctgtcagacctccgc
gcccaggtggccgccaaccagaagggcatccagctggtgggagagctcatcgggcagtac
ggcctggatgtggtgcaggcctacatgggccacattcaggcgaacgcggagccggctggg
cgaggaaagcctgcgggccttcggaacctcccggctggtctcctgatgccagctttcccc
ctccaacgtctgccagtgtgtaccagttaa

DBGET integrated database retrieval system