KEGG   Panthera tigris altaica (Amur tiger): 102954897
Entry
102954897         CDS       T02988                                 

Gene name
HPRT1
Definition
(RefSeq) hypoxanthine phosphoribosyltransferase 1
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102954897 (HPRT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102954897 (HPRT1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     102954897 (HPRT1)
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Other DBs
NCBI-GeneID: 102954897
NCBI-ProteinID: XP_007094462
LinkDB
Position
Un
AA seq 218 aa
MATRSPSIVISDDESGYDLDLFCIPNHYAQDLEKVFIPHGLIMDRTERLARDVMKEMGNH
HIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYNPKMVRVASLLVKRTPRSVGYRPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcaacgcggagccccagcattgtgattagtgatgatgaatcgggttatgatctagat
ttattttgtatacctaatcattatgctcaggatttggaaaaggtgtttattcctcatgga
ttaattatggacaggacggaacggcttgcacgagatgtgatgaaggaaatgggaaaccat
cacatcgtagccctctgtgtgctcaaggggggctataaattctttgctgacctgctggat
tacattaaagcactgaacagaaatagtgacaaatccattcctatgactgtagatttcatt
agactgaaaagctactgtaatgaccagtcaacaggggatataaaagtaattggtggagat
gatctctcaactttaactggaaagaatgtcttgattgttgaagatataattgacactggc
aaaacaatgcaaaccttgctttccttggtcaagcagtataatccaaagatggtcagggtt
gcaagcttgctggtgaaaaggactcctcgaagtgttggatacagaccagactttgttgga
tttgaaattccagacaagtttgttgtaggttatgcccttgactataatgaatatttcagg
gatttgaatcatgtttgtgtcattagtgaaactggaaaagcaaaatacaaagcctaa

DBGET integrated database retrieval system