KEGG   Panthera tigris altaica (Amur tiger): 102954958
Entry
102954958         CDS       T02988                                 

Gene name
CD28
Definition
(RefSeq) CD28 molecule
  KO
K06470  CD28 antigen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04514  Cell adhesion molecules
ptg04660  T cell receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05162  Measles
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05320  Autoimmune thyroid disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102954958 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102954958 (CD28)
   04672 Intestinal immune network for IgA production
    102954958 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102954958 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102954958 (CD28)
   05323 Rheumatoid arthritis
    102954958 (CD28)
   05320 Autoimmune thyroid disease
    102954958 (CD28)
   05330 Allograft rejection
    102954958 (CD28)
   05332 Graft-versus-host disease
    102954958 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102954958 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102954958 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    102954958 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102954958 (CD28)
CD molecules [BR:ptg04090]
 Proteins
  102954958 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set SUA5
Other DBs
NCBI-GeneID: 102954958
NCBI-ProteinID: XP_007090030
LinkDB
Position
Un
AA seq 221 aa
MILRLLLALNFFPSIQVTENKILVKQLPRLVVYNNEVNLSCKYTHNLFSKEFRASLYKGV
DSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRNLFVNQTDIYFCKIEVMYP
PPYIDNEKSNGTIIHVKEKHLCPAQLSPESSKPFWALVVVGGILGFYSLLATLALCACWM
KTKRSRILQSDYMNMTPRRPGPTRRHYQPYAPARDFAAYRS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgatcctcaggctgcttctggctctcaacttcttcccctcaattcaagtaacagaaaac
aagattttggtgaagcagttgcccaggcttgtggtgtacaacaatgaggtcaaccttagc
tgcaagtatactcacaacctcttctcaaaggagttccgggcatccctttataagggagta
gatagtgctgtggaagtctgcgttgtgaatggaaattactcccatcagcctcagttctac
tcaagtacaggattcgactgtgatgggaaattgggcaatgaaacagtgacattctacctc
cgaaatttgtttgttaaccaaacggatatttacttctgcaaaattgaagtcatgtatcca
cctccttacatagacaatgagaagagcaatgggaccattatccacgtgaaagagaaacat
ctttgtccagctcagctgtctcctgaatcttccaagccattttgggcactggtggtggtt
ggtggaatcctaggtttctatagcttgttagcaacattggccctttgtgcttgctggatg
aagaccaagaggagtaggatccttcagagtgactatatgaacatgaccccccggaggcca
gggcccacccgaaggcactaccaaccctacgccccagcacgcgactttgcggcataccgt
tcctga

DBGET integrated database retrieval system