KEGG   Panthera tigris altaica (Amur tiger): 102955223Help
Entry
102955223         CDS       T02988                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04064  NF-kappa B signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05166  Human T-cell leukemia virus 1 infection
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102955223 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102955223 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102955223 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102955223 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102955223 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102955223 (TNFRSF13C)
   04090 CD molecules [BR:ptg04090]
    102955223 (TNFRSF13C)
Cytokine receptors [BR:ptg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102955223 (TNFRSF13C)
CD molecules [BR:ptg04090]
 Proteins
  102955223 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 102955223
NCBI-ProteinID: XP_007079578
LinkDB All DBs
Position
Un
AA seq 143 aa AA seqDB search
MGSQRRGARSLRGREGAAPTKCVADKCFDPLVRKCVDCRLLRTPEPRPGKSRPALPAGQR
GSPGEGEEVPATAAPPLPEPQPPEPLDDVIIHPPKPLDATAPVWPPPREDPANTPPAHSV
PVPATELGSTELVTTKTAGPEQQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccagaggagaggtgccaggagcctgcggggcagggagggggcggcccccacc
aagtgtgtggcggacaagtgctttgaccctctggtccgaaagtgcgtggactgcaggctc
ctccggacgccagaacccagaccgggtaagagtcgacccgctctgccagctggtcagcgg
ggcagccctggggagggggaggaggttcctgctaccgctgccccaccgctgccagagccc
cagccaccagagcccctggacgatgtcatcatccatcccccgaaaccccttgatgccaca
gctcccgtctggcctccacccagagaagacccagccaacaccccacctgcccacagcgtc
cctgtgccagccacagagctgggctccactgagctggtgaccaccaagactgctggccct
gagcaacagtag

DBGET integrated database retrieval system