KEGG   Panthera tigris altaica (Amur tiger): 102955313
Entry
102955313         CDS       T02988                                 

Gene name
ABCC2
Definition
(RefSeq) ATP binding cassette subfamily C member 2
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg01524  Platinum drug resistance
ptg02010  ABC transporters
ptg04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    102955313 (ABCC2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102955313 (ABCC2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102955313 (ABCC2)
   01523 Antifolate resistance
    102955313 (ABCC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102955313 (ABCC2)
Transporters [BR:ptg02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    102955313 (ABCC2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 Dynamin_N AAA_29 RsgA_GTPase AAA_16 FtsK_SpoIIIE MeaB P-loop_TraG DUF87 DUF2884 AAA_10
Other DBs
NCBI-GeneID: 102955313
NCBI-ProteinID: XP_015392172
LinkDB
Position
Un
AA seq 1542 aa
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLLHVYRTKINRSS
ITKLYLAKQVLVGLLLILAAIELALVLTEDSGQATVPAIRYTNPSLYLGTWLLVLLFQHS
RLWCVRKDSWFLSLFWILSVLCGVFQFQTLIRTLLKGNNSNLAYSCLFFICYALNVLILI
LSAFSEKDDSSNNPSFTASFLSSITFSWYDSIVLKGYKQPLTLEDVWDLDEKIKTKTLVS
KFEKCMARELQKARKAVQRRQRGRAQGNSGDRLHGLNKNQSQSQDILVLEDVKKKEKSGT
TENFPKAWLVKSLFKTFYVLLLKSFLLKLMHDLLMFLNPQLLKLLISFANNRDAYVWAGY
LYSVLFFVVVLIQSLCLQNYFQLCFMLGTSVRATIMASIYKKALTLSNQSRKKYTIGETV
NLMSVDAQKLMDVTSFIHLLWSNILQITLSISFLWAELGPSVLAGVGVMVLLIPINGILA
AKSRAVQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKKQVRELRKKELKNLLIFGQ
MQTIMIFLLQLSPVLVSVITFSVYVLVNSNNVLDAEKAFTSITLFNILRFPLGMFPMVIT
SMLQASVSTERLEKYLGGDDLDTSAIRHEYNFDKAVQFSEASFTWDRDLEATIRDVNLDI
MPGQLVAVVGTVGSGKSSLMSAMLGEMENVHGHITIKGTIAYVPQQSWIQNGTLKDNILF
GSELDEKKYQQVLEACALLPDLEVLPGGDLAEIGEKGINLSGGQKQRISLARATYQNSDI
YVLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLITHSIRFLPQVDEIVVLGNGTILE
KGSYSTLLAKKGLFAKILKTSTKQMGLEGEATVNEDSEEDDCGLMPSVEEIPEEVASLTM
RRENSLHRTLSHSSRSSSRHRKSLKNSLKTRNVNTLKEEEELVKGQKLIKKEFIQTGKVK
LSIYLKYLRAMGLCLIFFIIIAYVINAVAYIGSNLWLSAWTNDSKTYNGTNYPASQRDLR
VGVYGALGLVQGVFMLLGNLCSACASTHASNILHKQLLTNILRAPMSFFDTTPTGRIVNR
FAGDISTVDDTLPLSLRSWILCFLAIISTLVMICIATPIFITIIIPLGIIYTFVQMLYVA
TSRQLKRLDSVTRSPIYSHFSETVSGLSVIRAFEHQQRFLKHNEVGIDTNQKCVFSWIVS
NRWLAVRLELIGNLIVFFASMMMVIYRDTLSGDTVGFVLSNALNITQTLTWLVRMTSEVE
TNIVAVERINEYIKVENEAPWVTDKRPPPGWPSKGEIQFNNYQLRYRPELDLILKGITCD
IKSMEKVGVVGRTGAGKSSLTNALFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIPQD
PILFSGSLRMNLDPFNNHSDEEIWKALELAHLKSFVAGLQLGLSHKVTEAGDNLSIGQRQ
LLCLARALLRKSKILIMDEATAAVDIETDHLIQTTIQKEFSHCTTITIAHRLHTIMDSDK
IMVLDNGKIVEYGTPNELLKNSGPFCLMAKEAGIENVNSTSL
NT seq 4629 nt   +upstreamnt  +downstreamnt
atgctggagaagttctgcaactctacattttggaattcttcattcctggatagcccagaa
gcagacctgccactttgttttgagcaaactgttctggtgtggattcccttgggtttcctt
tggctcctggccccttggcagcttcttcatgtatacagaaccaagatcaacagatcatct
atcaccaaactctatcttgctaagcaggtgcttgttgggctccttcttattctagcagcc
atagaactggcccttgtactcacagaagactctggacaagccacggtccctgccattaga
tataccaatccaagcctttacctgggcacatggctcctggttttgctgttccaacacagc
agactatggtgtgtgcggaaggactcttggttcctgtccctattctggattctctcagta
ctctgtggcgtcttccagtttcagactctgatccggacactcttaaagggcaacaattct
aatctggcttattcctgcctgttcttcatctgctatgcactgaacgtcctgatcctgata
ctttcagcattttcagaaaaagatgactcctcaaataatccatcattcacggcttcattt
ctgagtagcattacctttagttggtatgacagcattgttctgaaaggctacaagcaacct
ctgacactcgaagatgtctgggatcttgatgaaaagattaaaacgaagacactggtcagc
aagtttgaaaaatgtatggcacgagagctgcagaaggccaggaaggcagtccagagacga
cagcgggggagagcacaggggaactccggggacaggctgcatggcttgaacaagaatcag
agtcaaagccaagatatccttgtcctggaagacgttaaaaagaaagaaaagtctggcacc
acagaaaactttcccaaggcctggttggtcaagagtctcttcaaaaccttctacgtccta
ctcttgaagtccttcctactgaagctgatgcatgacctcctcatgtttctgaatcctcag
ctgctgaaattgctgatctcctttgcaaataaccgagacgcgtatgtgtgggctggatat
ctctattcagtcctcttctttgttgtggtcctcatccagtctctctgccttcagaattac
tttcaactgtgcttcatgctggggacaagtgtgcgggcaaccatcatggcttccatatat
aagaaggcgctgaccctatccaaccagagcagaaagaaatacaccattggagaaactgtg
aacctgatgtctgtggatgcccagaagctcatggatgtgaccagcttcatccatttgctg
tggtcaaatattctacagattactttatctatctccttcctatgggcagagctgggaccc
tcagtcttagcaggtgttggggtgatggtacttctaatcccaattaatgggatacttgcc
gccaagagtagagctgttcaggtaaaaaatatgaagaataaagacaaacgtttaaagatc
atgaatgaaattctcagtgggatcaagatcctgaagtattttgcctgggaaccttcattc
aaaaagcaagtccgtgaacttcggaagaaagagctcaagaacctgctgatcttcggtcag
atgcagactataatgatatttctcttacaattaagtccagtcctggtgtctgtgatcaca
ttttcagtttacgttctggtgaatagcaataatgttttggatgcagaaaaggccttcacc
tccatcaccctcttcaatatcctgcgtttccccctgggtatgtttccgatggtaatcacc
tccatgttacaggccagcgtttctacagaacggctagaaaagtacttgggaggggatgac
ttggacacatccgccattcgacatgagtacaattttgacaaagctgtgcagttttcagag
gcctcctttacctgggaccgggatctggaagctacaattcgagatgtgaacctggacatt
atgccaggccaattggtggctgtggtgggcactgtgggctctgggaagtcttccttgatg
tcagccatgctgggagaaatggaaaatgtccacgggcacatcaccatcaagggcactata
gcctatgtcccacagcaatcctggatccagaatggcaccttaaaggacaacatccttttt
ggatctgagttggatgaaaagaaataccagcaggttctggaggcctgtgccctcctccca
gacttggaagtgctgcccggaggagacctggccgagattggagagaagggtataaatctc
agtgggggtcagaagcagcggattagcctggccagagctacctatcaaaattcagacatc
tacgttctggatgaccccctgtcagccgtggatgctcatgtgggaaaacatattttcaat
aaggtcttgggtcccaatggcctattgaaaggcaagactcgactcttgattacacatagc
attcgctttcttccccaagtggatgagattgtggttctggggaatggcaccatcctggag
aagggatcctacagcactctgctggccaagaaaggattgtttgctaagattctgaagaca
tccacaaaacagatgggtcttgaaggagaggccacagtcaatgaggacagtgaagaagat
gactgtgggctgatgcccagtgtggaggaaatccctgaggaggtggcctccttgaccatg
agaagagagaacagccttcatcgaacacttagtcacagttctaggtccagtagcaggcac
cggaaatccctaaaaaactctttgaaaactcggaatgtgaataccctgaaggaggaggaa
gaactagtgaaaggacaaaaactaattaagaaggaattcatacaaactggaaaggtgaag
ctgtccatctacctgaaatacctgcgagccatgggattgtgtttgatattcttcatcatc
attgcctatgtgatcaatgctgtggcttatattggatccaacctctggctcagtgcttgg
accaatgactctaaaacctataatggcactaactatccagcctcacagagggacctgaga
gttggcgtctatggagctctgggattggtacaaggtgtgtttatgctcctaggaaatctt
tgcagtgcctgtgcttccactcacgcgtcaaacatccttcacaagcaactgctaaccaat
atccttcgagcacccatgagtttttttgacacaacacccacaggccggattgtgaacagg
ttcgctggtgatatctccacggtggatgacaccctccccttgtccctgcgaagctggata
ctgtgcttcctggcaatcatcagcacccttgtcatgatctgcatagccactcccatcttt
atcaccatcatcattccccttggcatcatttatacatttgtgcagatgttgtatgtggct
acttcccgccagctgaaacgtctggactctgtcaccaggtccccaatctactctcacttc
agtgagactgtgtcaggtttgtctgtcatccgtgcctttgagcatcagcagcgatttcta
aaacataatgaggtggggattgacaccaaccagaaatgtgtcttctcttggattgtctcc
aacaggtggcttgcagtccgtctggagctgattgggaacctgattgtcttctttgcatct
atgatgatggttatttatagagatacactaagtggagacactgtgggctttgttctgtcc
aatgcacttaatatcacacaaaccctgacctggttagtgaggatgacgtcagaagtagag
accaacattgtggctgttgaacgaataaatgagtacatcaaagtggaaaacgaggcaccc
tgggtgactgataagagacctcccccaggttggcccagcaaaggggagatccagttcaac
aactaccaactacggtaccggcctgagctggatctcatactgaaagggatcacctgtgac
attaagagtatggagaaggttggtgtggtcggcaggacaggagctgggaagtcatccttg
acaaatgccctcttcagaatcctagaggctgcaggtggccagatcatcattgatggggta
gatattgcttccattgggctccatgacctccgagagaaactgaccatcatcccccaggat
cccatcctgttctctggaagcctgaggatgaatctagatccctttaacaaccactcagat
gaggagatttggaaggccctggagctggctcacctcaaatcctttgtggctggcctgcaa
cttggattgtcccacaaagtgacagaggctggtgacaaccttagcatagggcagaggcag
ctgctgtgcctggccagggctctgcttcggaaatccaagattctgatcatggatgaggcc
actgctgcggtggatatagagaccgatcaccttatccagacgaccatccaaaaggagttc
tcccactgcacgactatcaccattgctcataggctccacaccatcatggacagtgacaag
ataatggtcctagacaacgggaagattgtagagtatggcacccctaacgaactgctgaaa
aattctggccccttttgtttgatggccaaagaagctggcattgaaaatgtgaatagcaca
tcactctga

DBGET integrated database retrieval system