KEGG   Panthera tigris altaica (Amur tiger): 102955418
Entry
102955418         CDS       T02988                                 

Gene name
CDA
Definition
(RefSeq) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102955418 (CDA)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102955418 (CDA)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     102955418 (CDA)
SSDB
Motif
Pfam: dCMP_cyt_deam_1
Other DBs
NCBI-GeneID: 102955418
NCBI-ProteinID: XP_007083887
LinkDB
Position
Un
AA seq 161 aa
MAGETIGSHCSAGKRGLTGYPVPTAYTYQAVEHSPSLRWNGVSLLLNTCHGKWFCWKSHW
FPPLFSGCNIENVCYPMGVCAERTAIQKAISEGHREFRAIAISSDLQDDFISPCGACRQV
MREFGTNWAVYMTKPDGTYVVRTVLELLPAPFGSLGPQKIQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcaggagaaaccatcggctcccactgctcagctggaaagcgaggtctgactggctac
cctgtgccaactgcctacacctaccaggcagtggaacacagtccctccctgcgttggaat
ggggtaagcctcttactcaacacctgccatgggaagtggttctgctggaagtctcattgg
ttccctcctctcttctcagggtgcaacattgaaaacgtctgctacccaatgggcgtctgt
gcggagcgaaccgccatccagaaggctatctcagaagggcacagggagttcagggcaatt
gctatctctagtgacctccaggatgattttatctcaccatgtggagcctgtaggcaagtc
atgagagagtttggcaccaactgggctgtctacatgaccaagccggatggcacatatgtt
gtcaggacagtcctggagctgctacctgcccccttcgggtccttgggcccgcagaagatc
cagtga

DBGET integrated database retrieval system