KEGG   Panthera tigris altaica (Amur tiger): 102955436Help
Entry
102955436         CDS       T02988                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102955436 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptg03036]
    102955436 (SETD2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102955436 (SETD2)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102955436 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 102955436
NCBI-ProteinID: XP_015395871
LinkDB All DBs
Position
Un
AA seq 2520 aa AA seqDB search
MFKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSP
AGPLQVDLTPKIKMDIGDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLLTTATAVV
SPPPPVVPLPAVIAESTTIDSPPSSPPPPPPPPQATTPSPPAPVTEPVALPHTPIPVLMT
APVDVAVRILKEPPATTVPESSDVDTKQDAVSNSSGEHITQNLNEQADTPSQKEDSHIGK
EEEIPDSSKSNLGSKKTGSKKKSSQSEGTFLASESDEDSVRTSSSQRSHDLKFSASIEKE
RDSKKSLAPLKSEDLGKSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRSRSRSR
SDRGSRTSLSYSRSERSHYYDSDRRYHRSSPYRERARYSRPYTDNRARESSDSEEEYKKT
YSRRTSSHSFSYRDLRTSSSYSKSDRDCKTESSYLEMEKRGKYSSKVERESKRTSENEAM
KRCCSPPNELGFRRGSSYSKHDNSASRYKSALSKSVSKSDKFKNSFCCTELNEEIRSSHS
FNLQAPCSKGSELRMISKIPEREKTGSPSPSNRLNDSPTFKKLDESLIFKSELIGHDSHD
SIKELDSLSKVKNDQLRSYCPIELNINGSPGAESDLATFCTSKTDTVLMSSDDSVTGSEV
SPLVTACMLSSNGFQNINRCKEKDSDNTCMLRSKSGSPFRETEPTVSPHQDKHMSLPVTT
IDYSKTVIKEPVDMTVSHCKTKDSDLYCTSNDNNPSLRHSEAEKIEPSVMKISSNSFMNV
HLKSKTVICDNRNLTDQHSKFAREEYKQSVGSTSSASVNHFDDIYQPIESSGVASSLQSL
PPGVKVDSLTLLQCGENASPVLDAVLKSKSTEFVKHAEKETIIEVGSGLPDSGRGFASWE
NRHNNGLSGKCVQEAQEEGNSIVLERRGRSEMSLDEEGGRGHAHTSDDSEVVFSSCDLNL
TMEDSDGIAYTLKCDSSGHASEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSFPRNRLQ
SVVVVPKNSTLPTEETSPCSSRSSQSYRHYSDHWEDERLESRRHSYEEKFDSVASKPCSQ
TEKFFHHKGTEKNPEISFTHPSRKQIDNHLSEIVHPQSDGVDSTSHTDVKSDFLGHPNSE
ETAKAKIASRQQEELPVYSSDDFEDVPNKSRQQTIFPNRPDSRLGKTELSFSSSCDISRV
DGFRSSEELRNLGWEFSQQEKPTTTYQQPDSSYGACGGHKYQQSAEHYGGTRNYWQGNGY
WDPRSAGRPPGTGVVYDRIQGQVPDSLTDDREEEDNWDQCAGSHFSSQSSKFFLSLQKDK
GSVQAPEISSNSIKDSLAVNEKRDLSKNLEKNDMKDRGPPKKRRPELESDSESDGELQDR
KKVRVAVEQGETAVPPGSALVGPSCVMEDFRDPQRWKECAKQGKMPCYFDLIEENVYLTE
RKKNKSHRDIKRMQCECAPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRF
QRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHY
YFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTF
DYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALME
NGEGLSDKNQVLSLSRLMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMA
ELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAIPPLSEGDGYS
SENTSRAHTPLNTPDPSTKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKD
GKEDLDQLEHVPVEEEEELQSQQLLTQQLPESKVESEIAMEASKLPISEPEADAEIEPKE
GNGTKLEETIAEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYR
IPKKSQTEKENTITERGRDAVGFRDQTAAPKTPNRSRERDPDKQTQNKEKRKRRGSLSPP
SSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNL
GMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYD
HSQPLVGHSTEPLAAPPPVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSSVTVLPVPAPGP
VQGQNYGVWDSNQQSVSVPQQYSPAQSQATIYYQGQTCPAVYGVTSPYSQTTPPIVQSYA
QPSLQYIQGQQIFTAHPQGVVVQPAAAVTAIVTPGQPQPLQPPEMVVTNNLLDLPPPSPP
KPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTY
DENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTED
FKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7563 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaggtgttgcttctagtcgatttttacctaaaggcaccaagacaaaagttaat
ttggaggaacagggacgacaaaaggtgtctttcagcttcagccttacaaagaaaactttg
cagaataggtttctgactgcacttggcaatgaaaagcaaaatgatactccaaactcccca
gctggacctcttcaagtagacttgactcctaaaataaaaatggacattggagatacctta
tctactacagaagaatcttccccaccaaaatcaagggtagaattgggcaaaattcatttt
aagaaacacctgcttcacgtgacgtccaggccactgttgactacagctacagcagtggtg
tctccacctcctccagtagtaccattaccagcagtcatagcagaatcaacaactatagat
tcaccaccctcttctccacctccaccacctccacctccccaggccacgacaccctcacca
ccagcaccagtaacagagccagtggccttgccacacacaccaatcccagttctgatgaca
gcaccggtagatgtagcagttagaatactgaaggaaccaccagctacgactgtaccagaa
tcttcagacgtggacactaagcaggacgctgtatctaatagttcaggagaacacataact
caaaatttgaatgagcaagcagatactccctcacaaaaagaagattcccatattgggaag
gaagaagaaattccagatagttctaagagtaatctgggctctaaaaaaacaggttctaag
aagaaatcctcacaatccgaaggcacctttcttgcttcagaatctgatgaagattctgta
cggacttcctcaagtcaaagatcacacgatttaaaattttcagcaagcattgaaaaggaa
agagattcaaaaaagagcttagcacctttaaaaagtgaggatttagggaaatcttcacga
tctaaaacagagagagatgataaatattttagctactcaaaacttgaaagagatactcgg
tatatatcttctcgatgtagatcagagagagagcgaaggcggagcagatctcgctcaaga
tctgacagaggctctagaactagtttatcctattcccggtcggaacgatcccattattat
gactctgatcgtcgctaccatcggagttccccttaccgagagagggctcgctattctcgg
ccatatacagataacagagctcgggagagttctgactcagaagaggagtataagaagacc
tactcaaggcgcacctcatcccattccttctcttacagagacctaaggacatcgtcatcc
tattctaaatctgatcgggactgcaaaactgagtcctcttacttagagatggagaaaaga
ggaaagtattcttcaaaagtagaaagagaatccaaaaggacttcagaaaatgaagcaatg
aaaagatgttgttctccccctaatgaactgggattccgacggggctcatcctattccaag
catgataacagtgcttcccgttacaaatctgccctttcaaagtctgtatccaagtccgat
aaatttaagaattctttctgttgtacagaattaaatgaggaaatcagatcatctcattct
tttaatttacaggctccttgttcaaaaggtagtgaattaagaatgattagtaaaattcct
gaaagagaaaagactgggtctccatcaccatcaaatcgattaaatgattcacctactttt
aaaaagctagatgaatcccttatttttaaatctgaacttataggacatgatagccatgat
agtattaaggaattagactctttatctaaagtgaagaatgatcagttaagaagttattgt
cccatagaattaaatataaatggatctcctggggcagaatctgatttggcaacattttgc
acttctaaaactgacactgttttgatgtcttctgatgatagtgtgaccggatcagaggta
tcccctttggtcacagcatgcatgctttcatcaaatggatttcagaatattaatagatgt
aaagagaaagactcagacaatacgtgcatgctgcgtagtaagtcaggaagcccatttaga
gaaacagaacctacagtgtcgccacaccaagataaacacatgtctttgccagttacgact
atagattattccaaaactgtaattaaagaaccagttgatatgacagtttctcattgtaaa
accaaagattcagatctatactgtacttcaaatgacaacaacccttctttgcgtcattct
gaagctgaaaagattgagccttcggttatgaagatttcttcaaatagctttatgaatgtg
catttgaaatcaaaaacagttatatgcgataatagaaatctgacagatcagcactcaaaa
tttgcacgtgaagaatataagcagagcgttggtagcaccagttcagcttctgttaatcat
tttgatgacatatatcaaccgatagagagttcaggcgttgcttcatctcttcagagtctg
ccaccaggagtaaaagtggacagtttaactctcttacaatgtggagagaatgcatctcca
gttttggatgctgtgctgaagagtaaaagcacagagtttgtaaagcatgcagagaaagaa
accatcatagaagtaggtagcggccttcctgattcaggaaggggatttgcctcttgggaa
aacaggcataataatgggctctctgggaaatgtgtgcaagaggctcaagaagaagggaat
tccatagtgcttgagagaagaggaaggtcagaaatgtctttagatgaagaaggagggaga
ggacatgctcatacttctgatgactcagaagttgtattttcttcttgtgacttgaattta
accatggaggacagtgatggcatagcatacaccttaaaatgtgacagtagtggtcacgcc
tcagagatcgtatccactgtccatgaagattattctgggtcttctgaaagctcaagtgat
gaaagtgactctgaagatacagattctgatgatagcagttttccaagaaaccgtcttcag
tctgttgtggtagtcccaaagaattctactttgcccacggaagaaaccagtccatgttct
tctcggagtagtcaaagttacagacactattctgaccactgggaagatgagagattggag
tcgaggagacattcatatgaggaaaaatttgacagtgtagcaagtaaaccttgttctcag
actgagaagttcttccatcataaaggaacagagaagaatccggaaatttcttttacacac
cccagcagaaaacagatagataaccacctgtctgaaattgttcatcctcagagtgacggg
gttgatagtacaagtcatacagatgtgaaatctgactttctaggtcatccaaattctgaa
gaaacagcaaaagccaaaatagcctctaggcagcaagaagagctgccagtttattcttct
gacgattttgaagacgtcccgaataagtctcggcaacaaaccattttccctaacaggcca
gatagtagactgggaaaaacagagttgagtttttcttcctcttgtgacatctcccgagtg
gatggcttccgctcatcagaagagctcaggaacctagggtgggaattctctcaacaagaa
aagcctacgaccacatatcagcaacctgacagcagctatggagcctgtggtggacacaag
tatcagcaaagtgcagaacattatggtgggacacgtaattactggcaaggtaatggctac
tgggatccaagatcagcaggtagacctcctggaacaggggttgtgtatgatcgaattcaa
gggcaggtaccagattccttaacagatgaccgtgaagaggaggacaattgggatcaatgt
gcagggtctcacttttcaagccagtccagtaaattttttctatcccttcagaaggacaag
gggtccgtgcaggcccctgaaataagcagcaattccattaaggactctttagctgtgaat
gaaaagagagatctttcaaaaaacttagaaaaaaatgatatgaaagatagagggcctcct
aaaaaaaggagaccggaattggagagtgattctgaaagcgatggtgaacttcaggacaga
aagaaagttcgagtggcagtagagcagggagaaacggcagtgcccccaggctcagcactg
gttgggccttcctgtgtcatggaggatttcagggacccacagcgatggaaagaatgtgcc
aagcaagggaagatgccctgttactttgatctgattgaagaaaatgtttatttaacagaa
agaaagaagaataaatcacatcgggatattaagcgaatgcagtgtgagtgtgcacctctt
tctaaagatgaaagagcgcaaggtgaaatagcatgtggggaagattgtcttaatcgtctc
ctcatgattgaatgttcttctcggtgtccgaatggggattattgttccaatagacggttt
cagagaaaacagcacgcagatgtggaagtcatactcacagaaaagaaaggctggggcttg
agagctgcgaaagaccttccttcgaacacctttgtcctggaatattgtggagaggtactt
gatcataaagagtttaaagcccgggtaaaggagtatgcacgaaacaaaaacatccactac
tatttcatggccctgaagaatgatgagataatagatgccactcagaaaggaaactgctct
cgtttcatgaatcacagctgtgaaccaaactgtgagactcaaaaatggactgtgaacgga
caactgagggtcgggttttttaccaccaaactagttccttcaggctcggagttaacattt
gattatcagttccaaagatatggaaaagaagctcagaaatgtttctgtgggtcagctaat
tgccgaggttacctgggaggagagaatagagtcagtatcagagcagcaggaggaaaaatg
aagaaggagcgatctcgtaagaaggattcagtggatggagagctagaagctctgatggag
aatggtgagggtctctctgataaaaaccaggtgctcagcttatcccggctaatggttaga
attgaaactttggagcagaaacttacctgtcttgagctcatacagaacacacattcacag
tcttgcctgaagtcctttctggaacgtcatgggctgtctttgttgtggatctggatggca
gagctaggtgatggccgggaaagtaaccagaagcttcaagaagagattataaagactttg
gaacacttacccattcctactaaaaatatgttggaggaaagcaaagtacttccaattatt
caacgctggtctcagaccaaaactgccattcctccgttgagtgaaggagatgggtattca
agtgagaatacgtcacgtgctcacacaccactcaacactcctgatccttccaccaagcta
agcacagaagctgacacagatacccccaagaagctcatgtttcgcagacttaaaattata
agtgaaaatagcatggacagtgcaatatctgatgctaccagtgagctggaaggcaaggat
ggcaaagaggaccttgaccagttagaacacgtccctgtagaagaagaggaagagttacag
tcacaacagctactcacacaacagctgcctgagtctaaagttgagagtgaaatcgccatg
gaagccagtaagctacccatatctgaaccagaggctgatgctgaaatagagcctaaagag
ggcaatggcacgaaactggaagaaactattgctgaggaaacaccatcccaagatgaagag
gagggtgtatctgatgtggagagtgagaggagccaggaacagccagataaaacagtagat
ataagtgatttggccaccaagctcctggatagttggaaagacctaaaggaggtttatcga
attccaaagaaaagtcaaactgaaaaggagaacacaataactgaacgaggaagggatgct
gttggcttcagagatcaaacagctgccccaaagactcctaacaggtcaagagagagagac
ccagacaagcaaactcaaaataaagagaaaaggaaacgaaggggctctctctcaccacct
tcttctgcctatgagcggggaacaaaaaggccagatgacagatatgatacaccaacttct
aagaagaaagttcgaattaaagaccgcaataaactttctacagaggagcgccggaagttg
tttgagcaagaggtggctcagcgggaggctcagaaacaacagcagcagatgcagaacctg
ggaatgacatctccactgccctatgactctctgggctacaatgcccctcatcaccccttt
gctggctacccaccaggttatcctatgcaggcctatgtggatcccagcaaccctaatgct
ggaaaggtgctcctccccacacctagcatggaccccgtgtgttctcctgctccttatgat
cattctcagcccttggtgggacattctacagaaccccttgctgcccctccacctgtacca
gtggtgccacatgtggcagcccctgtggaagtttccagttcacagtatgtggcccaaagt
gatggtgtggtacaccaagactccagcgtcaccgtcttgccagtgccagccccaggccca
gttcagggacagaattatggtgtttgggattcaaatcaacagtctgtcagtgtcccccag
cagtattctcctgcacagtctcaagcaaccatatattatcaaggacagacttgtccagct
gtctatggtgtgacatcaccctattcacagacaactccaccaattgtgcagagttatgcc
caaccaagtcttcagtacatccaaggacagcagattttcacagctcatccgcaaggcgtg
gtcgtacagccagctgcagccgtgactgcgatagtcacaccagggcagcctcagccctta
cagccgcctgaaatggtagtgacaaataatcttctggatctgccacccccctctcctccc
aaaccaaaaaccattgtcttacctcccaactggaagacagcccgagatccagaagggaag
atttattactaccacgtgatcacaaggcagactcagtgggatcctcctacttgggaaagc
ccaggagatgatgccagccttgagcatgaagctgaaatggacctggggaccccaacgtat
gatgaaaaccccatgaagacctcaaaaaagcctaagacagcagaagcagacacctccagt
gagctggctaagaaaagcaaagaagtattcagaaaagagatgtcccagttcatcgtccag
tgcctgaacccttaccggaaacctgactgcaaagtgggaagaatcaccacaactgaagac
ttcaaacacctagctcgcaagctgactcacggcgttatgaataaggagctgaagtactgt
aagaaccctgaggacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtatatt
aagaagtacatgcagaagtttggggctgtttacaaacccaaagaggacactgaattagag
tga

DBGET integrated database retrieval system