KEGG   Panthera tigris altaica (Amur tiger): 102955481
Entry
102955481         CDS       T02988                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04144  Endocytosis
ptg04151  PI3K-Akt signaling pathway
ptg04510  Focal adhesion
ptg04540  Gap junction
ptg04630  JAK-STAT signaling pathway
ptg04810  Regulation of actin cytoskeleton
ptg05163  Human cytomegalovirus infection
ptg05200  Pathways in cancer
ptg05206  MicroRNAs in cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102955481 (PDGFRA)
   04014 Ras signaling pathway
    102955481 (PDGFRA)
   04015 Rap1 signaling pathway
    102955481 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102955481 (PDGFRA)
   04020 Calcium signaling pathway
    102955481 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102955481 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102955481 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102955481 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102955481 (PDGFRA)
   04540 Gap junction
    102955481 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102955481 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102955481 (PDGFRA)
   05206 MicroRNAs in cancer
    102955481 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102955481 (PDGFRA)
   05231 Choline metabolism in cancer
    102955481 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102955481 (PDGFRA)
   05218 Melanoma
    102955481 (PDGFRA)
   05215 Prostate cancer
    102955481 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102955481 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102955481 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102955481 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102955481 (PDGFRA)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102955481 (PDGFRA)
Protein kinases [BR:ptg01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102955481 (PDGFRA)
CD molecules [BR:ptg04090]
 Proteins
  102955481 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 102955481
NCBI-ProteinID: XP_007075943
LinkDB
Position
Un
AA seq 1089 aa
MGTSHLALLVLVCLLTGPSLISCQLSLPSILPNENEKVVQLNSSFSLQCFGESEVSWQYP
MSEEENPNVEVRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTDENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPKTPVTLRSSDGVVHASYDSRQGFNG
TFSVGPYICEATVSGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTVLANNISNIITEVHRRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSTSDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKNGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKHEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFVKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccacctggcgctcctggtgttagtctgtctcctcacaggaccgagccta
atctcctgccagctttcattaccctctatccttccaaacgaaaatgaaaaggtcgtgcag
ctgaattcctccttttctctgcaatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaagtcagaaatgaagaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcaatgcgtcggcggcccacacgggactgtacacttgc
tattacaaccacactcagacggacgaaaacgagatcgaaggcaggcgcatttacatctat
gtcccagacccagacgtagccttcgtacctctaggaatgacagattatttagttatcgtg
gaggacgatgactctgccatcataccttgtcgcacaactgatcccaagactccggttacc
ttacgcagcagtgacggggtggttcacgcctcctatgacagcagacagggctttaatggg
accttcagcgtcgggccctatatctgcgaagccacagtcagcgggaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaagct
ctcaaaactgtgtataagtccggggagacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacgatg
ctggaggagatcaaggtcccgtccatcaaactggtttacacgctgacggtccccgaggcc
acggtgaaggatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttccgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaggctgttgacctgcatgaagtcaaacatttcgtggtggacgtgcag
gcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgcgaaggaagaagacagcggccattacactattgtcgtccaaaatgaagac
gacgtgaagagctatactttcgaactcttaacgcaagttccctcgtctattctggacttg
gtcgacgaccaccatggctccaccgggggacagaccgtgagatgcacagcagaagggaca
cctcttcccgatatcgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacggttttggcaaacaacatctcgaacatcatcacggaggtccaccgccgggac
aggagtactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgcctggccaagaatcttcttggagccgagaaccgagagctgaagctggtggctcccacg
ctgcgttctgaactcacagtggcagctgcagtcctggtcctgctggtgattgtgatcatc
tccctcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcgatcagccccgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactctagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggtgcattcgggaaagtggtcgaaggaactgcctatggattgagccggtcccagcct
gtcatgaaagtagcagtaaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcatctggggccccatttaaacattgtgaacttg
ctgggggcctgcaccaagtcaggccctatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgacacccagagaag
ccaaagaaagagttggacatttttgggctgaaccctgctgatgaaagcacacggagttac
gttattttatcttttgaaaacaatggtgactatatggacatgaagcaagctgataccaca
cagtacgtccccatgctggaaagaaaagaggtttctaaatactcggacatccagagatcg
ctgtatgatcgcccggcctcgtataagaagaaatctacgtcagactcggaagtcaaaaac
ctcctttcagacgataactcagaaggcctgactctgctggatttgttgagctttacctat
caagtggcgcgagggatggaatttttggcttccaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcgcaaggcaaaatcgtgaagatctgtgacttcggcctggcc
agggacatcatgcacgattcaaactacgtgtccaaaggcagcacctttctccccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttgggggcaccccgtaccctggtatgatg
gtggattccactttctacaacaagatcaagaacgggtaccggatggccaagcctgaccac
gccaccagcgaagtctatgaaatcatggtcaagtgctggcacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgttgccgggacaatataagaag
agctacgaaaagattcacctggacttcttgaagagcgaccaccctgccgtggcgcgcatg
cgcgtggactcggacaacgcctacatcggcgtcacctacaaacacgaggaagacaagctg
aaggactgggaaggcagcctggacgagcagaggctgagtgcagacagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctcagaagagagcgccattgagacaggttccagcagctctaccttcgtc
aagagagaggatgaaaccatcgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system