KEGG   Panthera tigris altaica (Amur tiger): 102955671Help
Entry
102955671         CDS       T02988                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00051  Fructose and mannose metabolism
ptg00052  Galactose metabolism
ptg00500  Starch and sucrose metabolism
ptg00520  Amino sugar and nucleotide sugar metabolism
ptg00524  Neomycin, kanamycin and gentamicin biosynthesis
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg04066  HIF-1 signaling pathway
ptg04910  Insulin signaling pathway
ptg04930  Type II diabetes mellitus
ptg04973  Carbohydrate digestion and absorption
ptg05230  Central carbon metabolism in cancer
Module
ptg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ptg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102955671 (HK1)
   00051 Fructose and mannose metabolism
    102955671 (HK1)
   00052 Galactose metabolism
    102955671 (HK1)
   00500 Starch and sucrose metabolism
    102955671 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102955671 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102955671 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102955671 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102955671 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102955671 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    102955671 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102955671 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102955671 (HK1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102955671 (HK1)
Membrane trafficking [BR:ptg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102955671 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102955671
NCBI-ProteinID: XP_007095805
LinkDB All DBs
Position
Un
AA seq 922 aa AA seqDB search
MGQSCQRGCSEEASEKPIKPPLTEVKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDF
NPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTP
ENIVHGSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKKF
KASGVEGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTN
ACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEK
MVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKEI
LTRLGVEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGS
LYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLA
HFRLTKDMLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGG
TNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPR
MPLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVV
NDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGDEGRMCINMEWGAFGDN
GCLDDIRTLYDRLVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEP
LKTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCG
AGMAAVVDKIRENRGLDHLSVTVGVDGTLYKLHPHFSRIMHQTVQELSPNCNVSFLLSED
GSGKGAALITAVGVRLREEASS
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggggcagagctgccagcgaggatgcagtgaagaagcatctgaaaagcccatcaagccc
ccacttactgaagttaagattgacaagtatctctatgccatgcggctctccgacgaaacg
ctgatagatatcatgactcggttcaagaaggagatgaagaatggcctctcccgggatttt
aatccaacagccacagtgaagatgttgccaacgtttgtaaggtctattcctgatggttca
gaaaagggagatttcattgccctggatcttggcgggtcttcctttcgaattctgagggtg
caagtgaatcatgagcaaaaccagaatgttcacatggagtccgagatttatgacaccccg
gagaacatcgtgcacggcagtggaagccagcttttcgatcacgtcgccgagtgcctggga
gacttcatggagaaaaaaaaaatcaaggacaagaaattacctgtgggattcacgttttcc
ttcccttgtcggcagtccaaaatagacgaggccatcctgatcacctggacaaagaaattt
aaagcgagcggagtggagggaatggatgtggtgaagctgcttaacaaagccatcaaaaag
cgcggggactacgatgccaacattgtggctgtggtgaacgacacagtggggaccatgatg
acctgtggctacgacgaccagcagtgcgaagtcggcctcatcattggcactggcaccaac
gcgtgctacatggaggaactgaggcacattgacctggtggaaggcgatgagggcaggatg
tgcatcaacacggagtggggggcctttggggacgacgggtccctcgaagacatccgcacc
gagttcgaccgggagatagaccgtggctctctcaaccccgggaagcagctgtttgagaag
atggtcagtggcatgtacttgggggagctggttcgactgatcctggtcaagatggccaag
gagggcctcttatttgaaggacggatcaccccggagctgctcaccagggggaagttcaag
accagtgatgtgtcagccattgaaaagaataaggaaggcctccacaatgccaaagaaatc
ctgacccgcctgggagtggagccatctgatgacgactgtatttcagtccagcacgtgtgt
accattgtctcatttcgctctgccaacctggtggctgcaacgctgggcgccatcttgaac
cgccttcgagataacaagggcacacccaggctgcggaccacggttggtgtcgacgggtct
ctttacaagacgcacccacagtattcacgacgtttccacaagactctgaggcgcttggtg
cccgactccgatgtgcgcttcctcctctcggagagcggcagcggcaagggggccgccatg
gtcaccgcggtggcctaccgcctggccgagcagcaccggcagatcgaggagaccctggcc
cacttccgcctcaccaaggatatgctgctggaggtgaagaagagaatgcgggccgagatg
gacatgggcctgaggaaacagacgcacgaaaaggccgtagtcaagatgctgccctccttc
gtccggagcactccagacgggaccgagcatggtgacttcttggcccttgatcttggagga
acgaatttccgtgtcttactggtgaaaatccgcagtgggaaaaagagaacggtggaaatg
cacaacaagatctacgccattcccattgaaatcatgcagggcactggggaagagctgttt
gaccacatcgtctcctgcatctccgacttcctggactacatggggatcaaaggccccaga
atgcctctcggcttcacgttctcattcccctgcaagcagacgagcttggatgcgggaatc
ttgatcacctggacgaagggttttaaggcaaccgactgcgtggggcacgatgtagcaacc
ttactaagggatgcgatcaaaaggagagaggaatttgacctggacgtggtggctgtggtc
aatgacacggtgggcaccatgatgacctgtgcttatgaagagcctacctgcgaggttgga
ctcatcgtagggaccggcagcaacgcctgctacatggaagaaatgaagaatgtcgagatg
ctggagggggacgaggggcgaatgtgcatcaacatggagtggggtgcctttggggacaac
gggtgtctcgatgacatcagaactctctatgacagactggtggatgaatattctctaaac
gctggaaaacaaaggtttgagaagatgatcagtggtatgtacctgggtgagatcgtccgc
aacatcttgatcgacttcaccaagaaggggttcctcttccgagggcagatctctgagccg
ctgaagactcgcggcatttttcagaccaaatatctctcccagattgagagtgaccgatta
gcactgctccaggtccgggccatcctccagcagctgggcctgaatagcacctgtgacgac
agtatcctcgtcaagaccgtgtgcggggtggtgtccaaacgggccgcgcagctgtgcggt
gcgggcatggccgccgtggtggacaagatccgcgagaacagagggctggaccatctcagt
gtgactgtgggggtggatggaacactctacaagcttcatccgcacttctcgagaatcatg
caccaaaccgtgcaggagctgtcaccgaactgcaacgtgtccttcctcctgtccgaagac
ggcagtggcaagggggctgccctcatcacggccgtgggcgtccggctccgggaagaagcg
agcagctaa

DBGET integrated database retrieval system